Citrus Sinensis ID: 026399
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 239 | ||||||
| 255537805 | 236 | nucleoside diphosphate kinase, putative | 0.983 | 0.995 | 0.829 | 1e-110 | |
| 18416233 | 237 | nucleoside diphosphate kinase IV [Arabid | 0.991 | 1.0 | 0.790 | 1e-108 | |
| 21593387 | 237 | nucleoside diphosphate kinase 3 (ndpk3) | 0.991 | 1.0 | 0.786 | 1e-107 | |
| 224058260 | 237 | predicted protein [Populus trichocarpa] | 0.987 | 0.995 | 0.820 | 1e-107 | |
| 147864944 | 235 | hypothetical protein VITISV_041718 [Viti | 0.983 | 1.0 | 0.824 | 1e-107 | |
| 334186865 | 467 | Pleckstrin homology (PH) domain-containi | 0.966 | 0.494 | 0.789 | 1e-105 | |
| 224072202 | 236 | predicted protein [Populus trichocarpa] | 0.987 | 1.0 | 0.811 | 1e-105 | |
| 19744167 | 235 | NDPK III [Brassica rapa] | 0.983 | 1.0 | 0.803 | 1e-105 | |
| 15237018 | 238 | nucleoside diphosphate kinase III [Arabi | 0.991 | 0.995 | 0.795 | 1e-104 | |
| 294862567 | 238 | nucleoside diphosphate kinase 1 [Solanum | 0.987 | 0.991 | 0.792 | 1e-104 |
| >gi|255537805|ref|XP_002509969.1| nucleoside diphosphate kinase, putative [Ricinus communis] gi|223549868|gb|EEF51356.1| nucleoside diphosphate kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 403 bits (1036), Expect = e-110, Method: Compositional matrix adjust.
Identities = 199/240 (82%), Positives = 215/240 (89%), Gaps = 5/240 (2%)
Query: 1 MSSQIVRSASRAATARSLLSASKNSR-FYSEGRAVSAAAAVTFSGKLPYLVSSFGRAGSS 59
MSSQI+RSASRAA RSLLSASK S FYSEGRAV AAAV+ SGK +L S+F + GSS
Sbjct: 1 MSSQIIRSASRAA--RSLLSASKTSSCFYSEGRAV--AAAVSLSGKASFLASAFRKTGSS 56
Query: 60 TASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFK 119
T S W+SGA+AIPAA Y LQEQE HAAEMERTFIAIKPDGVQRGLI+EI++RFERKGFK
Sbjct: 57 TVSAQWISGALAIPAAVYMLQEQEAHAAEMERTFIAIKPDGVQRGLIAEIVARFERKGFK 116
Query: 120 LVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWEGEGVITYGRKLIGAT 179
LV IK+VVPSKEFAQKHYHDLKERPFF+GLC+FLSSGPVIAMVWEGEGVI YGRKLIGAT
Sbjct: 117 LVGIKVVVPSKEFAQKHYHDLKERPFFSGLCDFLSSGPVIAMVWEGEGVIKYGRKLIGAT 176
Query: 180 DPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEDLVNYTSNAEKWVYESN 239
DPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEI LWFKPE+LV+Y SNAEKW+Y N
Sbjct: 177 DPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEINLWFKPEELVSYASNAEKWIYGVN 236
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|18416233|ref|NP_567690.1| nucleoside diphosphate kinase IV [Arabidopsis thaliana] gi|45477149|sp|Q8LAH8.2|NDK4_ARATH RecName: Full=Nucleoside diphosphate kinase IV, chloroplastic/mitochondrial; Short=NDK IV; Short=NDP kinase IV; Short=NDPK IV; AltName: Full=Nucleoside diphosphate kinase 4; Flags: Precursor gi|4972094|emb|CAB43890.1| hypothetical protein [Arabidopsis thaliana] gi|7269239|emb|CAB81308.1| hypothetical protein [Arabidopsis thaliana] gi|11990430|dbj|BAB19789.1| nucleoside diphosphate kinase 4 [Arabidopsis thaliana] gi|26450853|dbj|BAC42534.1| unknown protein [Arabidopsis thaliana] gi|105829662|gb|ABF74700.1| At4g23900 [Arabidopsis thaliana] gi|332659424|gb|AEE84824.1| nucleoside diphosphate kinase IV [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|21593387|gb|AAM65336.1| nucleoside diphosphate kinase 3 (ndpk3) [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224058260|ref|XP_002299472.1| predicted protein [Populus trichocarpa] gi|222846730|gb|EEE84277.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147864944|emb|CAN83625.1| hypothetical protein VITISV_041718 [Vitis vinifera] gi|297742339|emb|CBI34488.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|334186865|ref|NP_001190817.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|332659423|gb|AEE84823.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224072202|ref|XP_002303650.1| predicted protein [Populus trichocarpa] gi|118486199|gb|ABK94942.1| unknown [Populus trichocarpa] gi|222841082|gb|EEE78629.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|19744167|dbj|BAB86842.1| NDPK III [Brassica rapa] | Back alignment and taxonomy information |
|---|
| >gi|15237018|ref|NP_192839.1| nucleoside diphosphate kinase III [Arabidopsis thaliana] gi|6225753|sp|O49203.1|NDK3_ARATH RecName: Full=Nucleoside diphosphate kinase III, chloroplastic/mitochondrial; Short=NDK III; Short=NDP kinase III; Short=NDPK III; Flags: Precursor gi|2829275|gb|AAC00512.1| nucleoside diphosphate kinase 3 [Arabidopsis thaliana] gi|3513740|gb|AAC33956.1| contains similarity to nucleoside diphosphate kinases (Pfam: NDK.hmm, score: 301.12) [Arabidopsis thaliana] gi|4539375|emb|CAB40069.1| nucleoside diphosphate kinase 3 (ndpk3) [Arabidopsis thaliana] gi|7267799|emb|CAB81202.1| nucleoside diphosphate kinase 3 (ndpk3) [Arabidopsis thaliana] gi|14334560|gb|AAK59688.1| putative nucleoside diphosphate kinase ndpk3 [Arabidopsis thaliana] gi|17065632|gb|AAL33810.1| putative nucleoside diphosphate kinase 3 [Arabidopsis thaliana] gi|332657561|gb|AEE82961.1| nucleoside diphosphate kinase III [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|294862567|gb|ADF45668.1| nucleoside diphosphate kinase 1 [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 239 | ||||||
| TAIR|locus:2123421 | 238 | NDPK3 "nucleoside diphosphate | 0.991 | 0.995 | 0.754 | 2e-95 | |
| TAIR|locus:2138101 | 237 | AT4G23900 [Arabidopsis thalian | 0.991 | 1.0 | 0.740 | 1e-93 | |
| MGI|MGI:97356 | 152 | Nme2 "NME/NM23 nucleoside diph | 0.631 | 0.993 | 0.629 | 7.4e-50 | |
| RGD|619877 | 152 | Nme2 "NME/NM23 nucleoside diph | 0.631 | 0.993 | 0.629 | 9.5e-50 | |
| UNIPROTKB|Q32Q12 | 292 | NME1-NME2 "Nucleoside diphosph | 0.631 | 0.517 | 0.629 | 1.2e-49 | |
| UNIPROTKB|P22392 | 152 | NME2 "Nucleoside diphosphate k | 0.631 | 0.993 | 0.629 | 1.2e-49 | |
| UNIPROTKB|P52174 | 152 | NME1-1 "Nucleoside diphosphate | 0.631 | 0.993 | 0.629 | 2e-49 | |
| UNIPROTKB|P52175 | 152 | NME1-2 "Nucleoside diphosphate | 0.631 | 0.993 | 0.622 | 2e-49 | |
| RGD|70497 | 152 | Nme1 "NME/NM23 nucleoside diph | 0.631 | 0.993 | 0.609 | 2e-49 | |
| UNIPROTKB|F1N910 | 158 | NME1 "Nucleoside diphosphate k | 0.635 | 0.962 | 0.625 | 3.2e-49 |
| TAIR|locus:2123421 NDPK3 "nucleoside diphosphate kinase 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 949 (339.1 bits), Expect = 2.0e-95, P = 2.0e-95
Identities = 181/240 (75%), Positives = 205/240 (85%)
Query: 1 MSSQIVXXXXXXXXXXXXXXXXKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGRA-GSS 59
MSSQI KN+RF+SEGRA+ AAAAV+ SGK+P S+F R+ GS
Sbjct: 1 MSSQICRSASKAAKSLLSSA--KNARFFSEGRAIGAAAAVSASGKIPLYASNFARSSGSG 58
Query: 60 TASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFK 119
AS+SW++G +A+PAAAY +Q+QEV AAEMERTFIAIKPDGVQRGLISEIISRFERKGFK
Sbjct: 59 VASKSWITGLLALPAAAYMIQDQEVLAAEMERTFIAIKPDGVQRGLISEIISRFERKGFK 118
Query: 120 LVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWEGEGVITYGRKLIGAT 179
LV IK++VPSK+FAQKHYHDLKERPFFNGLC+FLSSGPVIAMVWEG+GVI YGRKLIGAT
Sbjct: 119 LVGIKVIVPSKDFAQKHYHDLKERPFFNGLCDFLSSGPVIAMVWEGDGVIRYGRKLIGAT 178
Query: 180 DPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEDLVNYTSNAEKWVYESN 239
DPQKSEPGTIRGDLAV VGRNIIHGSDGPETAKDEI LWFKP++LV+YTSN+EKW+Y N
Sbjct: 179 DPQKSEPGTIRGDLAVTVGRNIIHGSDGPETAKDEISLWFKPQELVSYTSNSEKWLYGDN 238
|
|
| TAIR|locus:2138101 AT4G23900 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:97356 Nme2 "NME/NM23 nucleoside diphosphate kinase 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|619877 Nme2 "NME/NM23 nucleoside diphosphate kinase 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32Q12 NME1-NME2 "Nucleoside diphosphate kinase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P22392 NME2 "Nucleoside diphosphate kinase B" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P52174 NME1-1 "Nucleoside diphosphate kinase A 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P52175 NME1-2 "Nucleoside diphosphate kinase A 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|70497 Nme1 "NME/NM23 nucleoside diphosphate kinase 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N910 NME1 "Nucleoside diphosphate kinase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 239 | |||
| PLN02619 | 238 | PLN02619, PLN02619, nucleoside-diphosphate kinase | 1e-163 | |
| cd04413 | 130 | cd04413, NDPk_I, Nucleoside diphosphate kinase Gro | 9e-84 | |
| PTZ00093 | 149 | PTZ00093, PTZ00093, nucleoside diphosphate kinase, | 2e-83 | |
| pfam00334 | 135 | pfam00334, NDK, Nucleoside diphosphate kinase | 1e-82 | |
| PRK00668 | 134 | PRK00668, ndk, mulitfunctional nucleoside diphosph | 5e-80 | |
| smart00562 | 135 | smart00562, NDK, Enzymes that catalyze nonsubstrat | 1e-78 | |
| COG0105 | 135 | COG0105, Ndk, Nucleoside diphosphate kinase [Nucle | 1e-72 | |
| cd00595 | 133 | cd00595, NDPk, Nucleoside diphosphate kinases (NDP | 8e-53 | |
| PRK14540 | 134 | PRK14540, PRK14540, nucleoside diphosphate kinase; | 1e-50 | |
| PRK14544 | 183 | PRK14544, PRK14544, nucleoside diphosphate kinase; | 1e-36 | |
| PRK14541 | 140 | PRK14541, PRK14541, nucleoside diphosphate kinase; | 1e-35 | |
| PRK14543 | 169 | PRK14543, PRK14543, nucleoside diphosphate kinase; | 2e-34 | |
| PRK14542 | 137 | PRK14542, PRK14542, nucleoside diphosphate kinase; | 2e-33 | |
| PRK14545 | 139 | PRK14545, PRK14545, nucleoside diphosphate kinase; | 1e-31 | |
| PLN02931 | 177 | PLN02931, PLN02931, nucleoside diphosphate kinase | 7e-25 | |
| cd04415 | 131 | cd04415, NDPk7A, Nucleoside diphosphate kinase 7 d | 1e-23 | |
| cd04414 | 135 | cd04414, NDPk6, Nucleoside diphosphate kinase 6 (N | 4e-23 | |
| cd04416 | 132 | cd04416, NDPk_TX, NDP kinase domain of thioredoxin | 2e-21 | |
| cd04418 | 132 | cd04418, NDPk5, Nucleoside diphosphate kinase homo | 4e-19 | |
| cd04412 | 134 | cd04412, NDPk7B, Nucleoside diphosphate kinase 7 d | 7e-17 |
| >gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase | Back alignment and domain information |
|---|
Score = 450 bits (1158), Expect = e-163
Identities = 205/240 (85%), Positives = 220/240 (91%), Gaps = 3/240 (1%)
Query: 1 MSSQIVRSASRAATARSLLSASKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGRA-GSS 59
MSSQI RSASRAA RSLLS++KN+ F SEGRAV+AAAAV+ GK P L S+FGRA GSS
Sbjct: 1 MSSQICRSASRAA--RSLLSSAKNASFLSEGRAVAAAAAVSAGGKPPLLASAFGRATGSS 58
Query: 60 TASRSWLSGAIAIPAAAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFK 119
TAS W+SGA+A+PAA Y LQEQE HAAEMERTFIAIKPDGVQRGLISEIISRFERKGFK
Sbjct: 59 TASAQWISGALALPAAVYMLQEQEAHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFK 118
Query: 120 LVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWEGEGVITYGRKLIGAT 179
LVAIK+VVPSKEFAQKHYHDLKERPFFNGLC+FLSSGPV+AMVWEGEGVI YGRKLIGAT
Sbjct: 119 LVAIKVVVPSKEFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWEGEGVIKYGRKLIGAT 178
Query: 180 DPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEDLVNYTSNAEKWVYESN 239
DPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEI LWFKPE+LV+YTSNAEKW+Y N
Sbjct: 179 DPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEINLWFKPEELVSYTSNAEKWIYGVN 238
|
Length = 238 |
| >gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate | Back alignment and domain information |
|---|
| >gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates | Back alignment and domain information |
|---|
| >gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation | Back alignment and domain information |
|---|
| >gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237749 PRK14543, PRK14543, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein | Back alignment and domain information |
|---|
| >gnl|CDD|239878 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B | Back alignment and domain information |
|---|
| >gnl|CDD|239877 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues | Back alignment and domain information |
|---|
| >gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively | Back alignment and domain information |
|---|
| >gnl|CDD|239880 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species | Back alignment and domain information |
|---|
| >gnl|CDD|239875 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 239 | |||
| PLN02619 | 238 | nucleoside-diphosphate kinase | 100.0 | |
| PTZ00093 | 149 | nucleoside diphosphate kinase, cytosolic; Provisio | 100.0 | |
| PRK14543 | 169 | nucleoside diphosphate kinase; Provisional | 100.0 | |
| PRK14542 | 137 | nucleoside diphosphate kinase; Provisional | 100.0 | |
| COG0105 | 135 | Ndk Nucleoside diphosphate kinase [Nucleotide tran | 100.0 | |
| PRK14541 | 140 | nucleoside diphosphate kinase; Provisional | 100.0 | |
| PRK14545 | 139 | nucleoside diphosphate kinase; Provisional | 100.0 | |
| PRK14540 | 134 | nucleoside diphosphate kinase; Provisional | 100.0 | |
| PRK00668 | 134 | ndk mulitfunctional nucleoside diphosphate kinase/ | 100.0 | |
| PLN02931 | 177 | nucleoside diphosphate kinase family protein | 100.0 | |
| cd04415 | 131 | NDPk7A Nucleoside diphosphate kinase 7 domain A (N | 100.0 | |
| cd04418 | 132 | NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP | 100.0 | |
| cd04413 | 130 | NDPk_I Nucleoside diphosphate kinase Group I (NDPk | 100.0 | |
| PF00334 | 135 | NDK: Nucleoside diphosphate kinase; InterPro: IPR0 | 100.0 | |
| cd04414 | 135 | NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase | 100.0 | |
| cd04412 | 134 | NDPk7B Nucleoside diphosphate kinase 7 domain B (N | 100.0 | |
| cd00595 | 133 | NDPk Nucleoside diphosphate kinases (NDP kinases, | 100.0 | |
| KOG0888 | 156 | consensus Nucleoside diphosphate kinase [Nucleotid | 100.0 | |
| cd04416 | 132 | NDPk_TX NDP kinase domain of thioredoxin domain-co | 100.0 | |
| smart00562 | 135 | NDK These are enzymes that catalyze nonsubstrate s | 100.0 | |
| PRK14544 | 183 | nucleoside diphosphate kinase; Provisional | 100.0 |
| >PLN02619 nucleoside-diphosphate kinase | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.2e-74 Score=505.84 Aligned_cols=237 Identities=86% Similarity=1.307 Sum_probs=233.6
Q ss_pred CchHHHHHhhHHHHHHhhhhhcccccccccchhhhhhhhhhccCCcchhhhhhcc-cCCcchhhhhhhhhhhhhhhhhhh
Q 026399 1 MSSQIVRSASRAATARSLLSASKNSRFYSEGRAVSAAAAVTFSGKLPYLVSSFGR-AGSSTASRSWLSGAIAIPAAAYTL 79 (239)
Q Consensus 1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~ 79 (239)
|+|||||+++|+ ||++++++++++++.+||++++++++++++|.|++++.|+. +++++++.+|+++++++||++||+
T Consensus 1 ~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 78 (238)
T PLN02619 1 MSSQICRSASRA--ARSLLSSAKNASFLSEGRAVAAAAAVSAGGKPPLLASAFGRATGSSTASAQWISGALALPAAVYML 78 (238)
T ss_pred CchHHHHHHHHH--HHHHHHHHhhhhhhhcchHHHHHHHHHcCCCCchHHHHHHhhcCCCchHHHHHHHhhcchhhhhhc
Confidence 899999999999 99999999999999999999999999999999999999988 899999999999999999999999
Q ss_pred hhhhhhhhhhceeEEEEcCcccccCcHHHHHHHHHHcCceEEeEEEeccCHHHHHHHhhhhcCCCChHHHHHHHccCcEE
Q 026399 80 QEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVI 159 (239)
Q Consensus 80 ~~~~~l~~~~E~Tl~LIKPDav~~g~iG~II~~I~~~Gf~Iv~~Kmv~Ls~e~A~efY~~~~~k~~f~~Lv~~mtSGPvv 159 (239)
||++.+...+|+||+|||||++++|++|+||++|+++||+|+++||++||+++|++||.+|+++|||++|++||+|||++
T Consensus 79 ~~~~~~a~~~ErTlaiIKPDaV~rglvGeII~rIe~~Gf~Iva~Kmv~Lt~e~AeefY~ehkgKpFf~~Lv~fMtSGPvv 158 (238)
T PLN02619 79 QEQEAHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKVVVPSKEFAQKHYHDLKERPFFNGLCDFLSSGPVV 158 (238)
T ss_pred cccccccchhceEEEEECcchhhcCchHHHHHHHHHCCCEEEehhhccCCHHHHHHHHHHhcCCCcHHHHHHHHhcCCeE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEeecCHHHHHHHHhCCCCCCCCCCCCcccccccccCccEEEcCCChhhHHHHHhhcCCCCCccccccCCccccccCC
Q 026399 160 AMVWEGEGVITYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEDLVNYTSNAEKWVYESN 239 (239)
Q Consensus 160 aL~L~G~nAV~~~R~LiGptdp~~a~P~sLRa~fG~~~~~NaVHgSDs~e~A~rEi~~FF~~~el~~~~~~~~~~~~~~~ 239 (239)
+|+|+|+|+|++||++||||||.++.|+|||++||.+.++|+|||||++|+|++||+|||+++|+.+|.++.++|+|++|
T Consensus 159 amvL~GenaV~~~R~LiGpTdP~~A~PgTIRg~fG~~~~rNaVHgSDS~EsA~rEI~~fF~~~ei~~y~~~~~~~~y~~~ 238 (238)
T PLN02619 159 AMVWEGEGVIKYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEINLWFKPEELVSYTSNAEKWIYGVN 238 (238)
T ss_pred EEEEECCcHHHHHHHHhCCCCccccCCCcchhhhcccccceeeecCCCHHHHHHHHHHhCCHHhccCCcccchhhhccCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999998
|
|
| >PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional | Back alignment and domain information |
|---|
| >PRK14543 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14542 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14541 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14545 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14540 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated | Back alignment and domain information |
|---|
| >PLN02931 nucleoside diphosphate kinase family protein | Back alignment and domain information |
|---|
| >cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B | Back alignment and domain information |
|---|
| >cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species | Back alignment and domain information |
|---|
| >cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate | Back alignment and domain information |
|---|
| >PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 | Back alignment and domain information |
|---|
| >cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues | Back alignment and domain information |
|---|
| >cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B | Back alignment and domain information |
|---|
| >cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation | Back alignment and domain information |
|---|
| >KOG0888 consensus Nucleoside diphosphate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively | Back alignment and domain information |
|---|
| >smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates | Back alignment and domain information |
|---|
| >PRK14544 nucleoside diphosphate kinase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 239 | ||||
| 1w7w_A | 182 | Structure And Mutational Analysis Of A Plant Mitoch | 9e-81 | ||
| 3l7u_A | 172 | Crystal Structure Of Human Nm23-H1 Length = 172 | 6e-55 | ||
| 1bhn_A | 152 | Nucleoside Diphosphate Kinase Isoform A From Bovine | 2e-54 | ||
| 1nsk_R | 152 | The Crystal Structure Of A Human Nucleoside Diphosp | 2e-54 | ||
| 1be4_A | 151 | Nucleoside Diphosphate Kinase Isoform B From Bovine | 2e-54 | ||
| 1nue_A | 151 | X-ray Structure Of Nm23 Human Nucleoside Diphosphat | 2e-54 | ||
| 1jxv_A | 152 | Crystal Structure Of Human Nucleoside Diphosphate K | 5e-54 | ||
| 3bbc_A | 151 | Crystal Structure Of R88a Mutant Of The Nm23-H2 Tra | 1e-53 | ||
| 2hve_A | 152 | S120g Mutant Of Human Nucleoside Diphosphate Kinase | 2e-53 | ||
| 3prv_A | 157 | Nucleoside Diphosphate Kinase B From Trypanosoma Cr | 1e-52 | ||
| 1ucn_A | 152 | X-Ray Structure Of Human Nucleoside Diphosphate Kin | 4e-52 | ||
| 1ndl_A | 153 | The Awd Nucleotide Diphosphate Kinase From Drosophi | 1e-51 | ||
| 3ngr_A | 151 | Crystal Structure Of Leishmania Nucleoside Diphosph | 8e-51 | ||
| 1u8w_A | 149 | Crystal Structure Of Arabidopsis Thaliana Nucleosid | 1e-50 | ||
| 1nsq_A | 153 | Mechanism Of Phosphate Transfer By Nucleoside Dipho | 1e-50 | ||
| 3r9l_A | 155 | Crystal Structure Of Nucleoside Diphosphate Kinase | 1e-50 | ||
| 4fkx_A | 161 | Crystal Structure Of Nucleoside Diphosphate Kinase | 2e-50 | ||
| 4f36_A | 157 | Crystal Structure Of Nucleoside Diphosphate Kinase | 2e-50 | ||
| 1pku_A | 150 | Crystal Structure Of Nucleoside Diphosphate Kinase | 1e-48 | ||
| 1s57_A | 153 | Crystal Structure Of Nucleoside Diphosphate Kinase | 2e-48 | ||
| 1zs6_A | 169 | Structure Of Human Nucleoside-diphosphate Kinase 3 | 2e-48 | ||
| 3b54_A | 161 | Saccharomyces Cerevisiae Nucleoside Diphosphate Kin | 3e-48 | ||
| 1npk_A | 154 | Refined X-Ray Structure Of Dictyostelium Nucleoside | 1e-47 | ||
| 1ndp_A | 155 | Adenosine 5'-Diphosphate Binding And The Active Sit | 1e-47 | ||
| 1hhq_A | 155 | Role Of Active Site Resiude Lys16 In Nucleoside Dip | 4e-47 | ||
| 1lwx_A | 155 | Azt Diphosphate Binding To Nucleoside Diphosphate K | 7e-47 | ||
| 1hlw_A | 155 | Structure Of The H122a Mutant Of The Nucleoside Dip | 1e-46 | ||
| 1leo_A | 150 | P100s Nucleoside Diphosphate Kinase Length = 150 | 1e-46 | ||
| 1b4s_A | 155 | Structure Of Nucleoside Diphosphate Kinase H122g Mu | 1e-46 | ||
| 1nsp_A | 155 | Mechanism Of Phosphate Transfer By Nucleoside Dipho | 1e-46 | ||
| 1ndk_A | 155 | X-Ray Structure Of Nucleoside Diphosphate Kinase Le | 2e-46 | ||
| 1ncl_A | 150 | Thermal Stability Of Hexameric And Tetrameric Nucle | 2e-46 | ||
| 1pae_X | 155 | Nucleoside Diphosphate Kinase Length = 155 | 3e-45 | ||
| 1xiq_A | 157 | Plasmodium Falciparum Nucleoside Diphosphate Kinase | 5e-45 | ||
| 1mn7_A | 155 | Ndp Kinase Mutant (H122g;n119s;f64w) In Complex Wit | 6e-45 | ||
| 2vu5_A | 148 | Crystal Structure Of Pndk From Bacillus Anthracis L | 7e-45 | ||
| 1wkj_A | 137 | Crystal Structure Of Nucleoside Diphosphate Kinase | 2e-43 | ||
| 3q83_A | 157 | Crystal Structure Of Staphylococcus Aureus Nucleosi | 3e-43 | ||
| 2zua_A | 174 | Crystal Structure Of Nucleoside Diphosphate Kinase | 4e-42 | ||
| 3js9_A | 156 | Crystal Structure Of Nucleoside Diphosphate Kinase | 1e-41 | ||
| 1ehw_A | 162 | Human Nucleoside Diphosphate Kinase 4 Length = 162 | 1e-40 | ||
| 2az3_A | 164 | Structure Of A Halophilic Nucleoside Diphosphate Ki | 2e-40 | ||
| 2az1_A | 181 | Structure Of A Halophilic Nucleoside Diphosphate Ki | 4e-40 | ||
| 2cwk_A | 160 | Crystal Structure Of Nucleotide Diphosphate Kinase | 2e-38 | ||
| 3mpd_A | 151 | Crystal Structure Of Nucleoside Diphosphate Kinase | 6e-38 | ||
| 1k44_A | 136 | Mycobacterium Tuberculosis Nucleoside Diphosphate K | 3e-34 | ||
| 3pj9_A | 140 | Crystal Structure Of A Nucleoside Diphosphate Kinas | 3e-33 | ||
| 3ddi_A | 146 | Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R1 | 6e-33 | ||
| 3vgs_A | 141 | Wild-Type Nucleoside Diphosphate Kinase Derived Fro | 2e-32 | ||
| 3vgu_A | 141 | E134a Mutant Nucleoside Diphosphate Kinase Derived | 2e-32 | ||
| 3emt_A | 146 | Crystal Structure Of The Mimivirus Ndk +kpn-R107g D | 5e-32 | ||
| 3em1_A | 146 | Crystal Structure Of The Mimivirus Ndk +kpn-N62l Do | 5e-32 | ||
| 4dut_A | 145 | The Structure Of Nucleoside Diphosphate Kinase (Ndk | 5e-32 | ||
| 3ejm_A | 146 | Crystal Structure Of The Mimivirus Ndk +kpn Mutant | 3e-31 | ||
| 2nck_R | 144 | Crystal Structure Of Myxococcus Xanthus Nucleoside | 5e-31 | ||
| 1nb2_A | 150 | Crystal Structure Of Nucleoside Diphosphate Kinase | 6e-31 | ||
| 3fbe_A | 142 | Crystal Structure Of The Mimivirus Ndk N62l-R107g D | 4e-29 | ||
| 3evw_A | 142 | Crystal Structure Of The Mimivirus Ndk R107g Mutant | 3e-28 | ||
| 3fbf_A | 142 | Crystal Structure Of The Mimivirus Ndk N62l Mutant | 3e-28 | ||
| 2b8p_A | 157 | Crystal Structure Of Acanthamoeba Polyphaga Mimivir | 1e-27 | ||
| 2b8q_A | 142 | X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus | 2e-27 | ||
| 4di6_A | 190 | Crystal Structure Of Nucleoside-Diphosphate Kinase | 2e-26 | ||
| 2hur_A | 142 | Escherichia Coli Nucleoside Diphosphate Kinase Leng | 5e-26 | ||
| 3ztq_A | 142 | Hexagonal Crystal Form P61 Of The Aquifex Aeolicus | 1e-25 | ||
| 1xqi_A | 195 | Crystal Structure Analysis Of An Ndp Kinase From Py | 5e-21 |
| >pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification Of Residues Involved In Serine Phosphorylation And Oligomerization. Length = 182 | Back alignment and structure |
|
| >pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1 Length = 172 | Back alignment and structure |
| >pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina Length = 152 | Back alignment and structure |
| >pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate Kinase, Nm23-H2 Length = 152 | Back alignment and structure |
| >pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina Length = 151 | Back alignment and structure |
| >pdb|1NUE|A Chain A, X-ray Structure Of Nm23 Human Nucleoside Diphosphate Kinase B Complexed With Gdp At 2 Angstroms Resolution Length = 151 | Back alignment and structure |
| >pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A Length = 152 | Back alignment and structure |
| >pdb|3BBC|A Chain A, Crystal Structure Of R88a Mutant Of The Nm23-H2 Transcription Factor Length = 151 | Back alignment and structure |
| >pdb|2HVE|A Chain A, S120g Mutant Of Human Nucleoside Diphosphate Kinase A Complexed With Adp Length = 152 | Back alignment and structure |
| >pdb|3PRV|A Chain A, Nucleoside Diphosphate Kinase B From Trypanosoma Cruzi Length = 157 | Back alignment and structure |
| >pdb|1UCN|A Chain A, X-Ray Structure Of Human Nucleoside Diphosphate Kinase A Complexed With Adp At 2 A Resolution Length = 152 | Back alignment and structure |
| >pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila Length = 153 | Back alignment and structure |
| >pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate Kinase B With Unordered Nucleotide-Binding Loop. Length = 151 | Back alignment and structure |
| >pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 Length = 149 | Back alignment and structure |
| >pdb|1NSQ|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 153 | Back alignment and structure |
| >pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Giardia Lamblia Featuring A Disordered Dinucleotide Binding Site Length = 155 | Back alignment and structure |
| >pdb|4FKX|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei Bound To Cdp Length = 161 | Back alignment and structure |
| >pdb|4F36|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase B From Trypanosoma Brucei, Apo Form Length = 157 | Back alignment and structure |
| >pdb|1PKU|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Rice Length = 150 | Back alignment and structure |
| >pdb|1S57|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase 2 From Arabidopsis Length = 153 | Back alignment and structure |
| >pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-diphosphate Kinase 3 Length = 169 | Back alignment and structure |
| >pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase Length = 161 | Back alignment and structure |
| >pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside Diphosphate Kinase At 1,8 Angstroms Resolution Length = 154 | Back alignment and structure |
| >pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1HLW|A Chain A, Structure Of The H122a Mutant Of The Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase Length = 150 | Back alignment and structure |
| >pdb|1B4S|A Chain A, Structure Of Nucleoside Diphosphate Kinase H122g Mutant Length = 155 | Back alignment and structure |
| >pdb|1NSP|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 155 | Back alignment and structure |
| >pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside, Diphosphate Kinases Length = 150 | Back alignment and structure |
| >pdb|1PAE|X Chain X, Nucleoside Diphosphate Kinase Length = 155 | Back alignment and structure |
| >pdb|1XIQ|A Chain A, Plasmodium Falciparum Nucleoside Diphosphate Kinase B Length = 157 | Back alignment and structure |
| >pdb|1MN7|A Chain A, Ndp Kinase Mutant (H122g;n119s;f64w) In Complex With Abazttp Length = 155 | Back alignment and structure |
| >pdb|2VU5|A Chain A, Crystal Structure Of Pndk From Bacillus Anthracis Length = 148 | Back alignment and structure |
| >pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Thermus Thermophilus Hb8 Length = 137 | Back alignment and structure |
| >pdb|3Q83|A Chain A, Crystal Structure Of Staphylococcus Aureus Nucleoside Diphosphate Kinase Length = 157 | Back alignment and structure |
| >pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 | Back alignment and structure |
| >pdb|3JS9|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase Family Protein From Babesia Bovis Length = 156 | Back alignment and structure |
| >pdb|1EHW|A Chain A, Human Nucleoside Diphosphate Kinase 4 Length = 162 | Back alignment and structure |
| >pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 | Back alignment and structure |
| >pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 | Back alignment and structure |
| >pdb|2CWK|A Chain A, Crystal Structure Of Nucleotide Diphosphate Kinase From Pyrococcus Horikoshii Length = 160 | Back alignment and structure |
| >pdb|3MPD|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Encephalitozoon Cuniculi, Cubic Form, Apo Length = 151 | Back alignment and structure |
| >pdb|1K44|A Chain A, Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase Length = 136 | Back alignment and structure |
| >pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 | Back alignment and structure |
| >pdb|3DDI|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l-R107g Triple Mutant Complexed With Tdp Length = 146 | Back alignment and structure |
| >pdb|3VGS|A Chain A, Wild-Type Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 | Back alignment and structure |
| >pdb|3VGU|A Chain A, E134a Mutant Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 | Back alignment and structure |
| >pdb|3EMT|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-R107g Double Mutant Complexed With Dgdp Length = 146 | Back alignment and structure |
| >pdb|3EM1|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn-N62l Double Mutant Complexed With Dtdp Length = 146 | Back alignment and structure |
| >pdb|4DUT|A Chain A, The Structure Of Nucleoside Diphosphate Kinase (Ndk) From Burkholderia Thailandensis Length = 145 | Back alignment and structure |
| >pdb|3EJM|A Chain A, Crystal Structure Of The Mimivirus Ndk +kpn Mutant Complexed With Gdp Length = 146 | Back alignment and structure |
| >pdb|2NCK|R Chain R, Crystal Structure Of Myxococcus Xanthus Nucleoside Diphosphate Kinase And Its Interaction With A Nucleotide Substrate At 2.0 Angstroms Resolution Length = 144 | Back alignment and structure |
| >pdb|1NB2|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Bacillus Halodenitrificans Length = 150 | Back alignment and structure |
| >pdb|3FBE|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l-R107g Double Mutant Complexed With Gdp Length = 142 | Back alignment and structure |
| >pdb|3EVW|A Chain A, Crystal Structure Of The Mimivirus Ndk R107g Mutant Complexed With Dtdp Length = 142 | Back alignment and structure |
| >pdb|3FBF|A Chain A, Crystal Structure Of The Mimivirus Ndk N62l Mutant Complexed With Dtdp Length = 142 | Back alignment and structure |
| >pdb|2B8P|A Chain A, Crystal Structure Of Acanthamoeba Polyphaga Mimivirus Ndk, The First Viral Nucleoside Diphosphate Kinase Length = 157 | Back alignment and structure |
| >pdb|2B8Q|A Chain A, X-Ray Structure Of Acanthamoeba Ployphaga Mimivirus Nucleoside Diphosphate Kinase Complexed With Tdp Length = 142 | Back alignment and structure |
| >pdb|4DI6|A Chain A, Crystal Structure Of Nucleoside-Diphosphate Kinase From Borrelia Burgdorferi Length = 190 | Back alignment and structure |
| >pdb|2HUR|A Chain A, Escherichia Coli Nucleoside Diphosphate Kinase Length = 142 | Back alignment and structure |
| >pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 | Back alignment and structure |
| >pdb|1XQI|A Chain A, Crystal Structure Analysis Of An Ndp Kinase From Pyrobaculum Aerophilum Length = 195 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 239 | |||
| 1w7w_A | 182 | Nucleoside diphosphate kinase; NDPK3, transferase; | 1e-102 | |
| 3l7u_A | 172 | Nucleoside diphosphate kinase A; ATP-binding, nucl | 1e-101 | |
| 4fkx_A | 161 | NDK B, nucleoside diphosphate kinase; structural g | 1e-101 | |
| 1s57_A | 153 | Nucleoside diphosphate kinase II; transferase; HET | 1e-100 | |
| 3bbb_A | 151 | Nucleoside diphosphate kinase B; transcription fac | 1e-100 | |
| 3js9_A | 156 | Nucleoside diphosphate kinase family protein; niai | 1e-100 | |
| 3b54_A | 161 | NDK, NDP kinase, nucleoside diphosphate kinase; al | 1e-100 | |
| 3q8u_A | 157 | Nucleoside diphosphate kinase; ferridoxin fold, al | 1e-100 | |
| 1xiq_A | 157 | Nucleoside diphosphate kinase B; protein structure | 1e-100 | |
| 3r9l_A | 155 | Nucleoside diphosphate kinase; structural genomics | 1e-100 | |
| 1zs6_A | 169 | Nucleoside diphosphate kinase 3; nucleotide metabo | 1e-100 | |
| 2vu5_A | 148 | Nucleoside diphosphate kinase; nucleotide-binding, | 4e-99 | |
| 1pku_A | 150 | Nucleoside diphosphate kinase I; RICE, transferase | 1e-98 | |
| 1nb2_A | 150 | Nucleoside diphosphate kinase; bacillus halodenitr | 1e-98 | |
| 1u8w_A | 149 | Nucleoside diphosphate kinase I; nucleotide diphos | 2e-98 | |
| 2az3_A | 164 | Nucleoside diphosphate kinase; halophilic, transfe | 2e-97 | |
| 3mpd_A | 151 | Nucleoside diphosphate kinase; ssgcid, NIH, niaid, | 3e-97 | |
| 3fkb_A | 155 | NDP kinase, NDK, nucleoside diphosphate kinase, cy | 3e-97 | |
| 1ehw_A | 162 | NDPK H4, nucleoside diphosphate kinase; NM23, mito | 4e-95 | |
| 2dxe_A | 160 | Nucleoside diphosphate kinase; nucleoside binding, | 5e-95 | |
| 1nhk_R | 144 | Nucleoside diphosphate kinase; phosphotransferase; | 2e-93 | |
| 2hur_A | 142 | NDK, nucleoside diphosphate kinase, NDP kinase; ty | 3e-93 | |
| 1wkj_A | 137 | Nucleoside diphosphate kinase; thermus thermophilu | 5e-92 | |
| 3evo_A | 146 | NDP kinase, NDK, nucleoside diphosphate kinase; ph | 5e-92 | |
| 4dz6_A | 190 | Nucleoside diphosphate kinase; ssgcid, niaid, vana | 1e-91 | |
| 4ek2_A | 145 | Nucleoside diphosphate kinase; seattle structural | 8e-91 | |
| 3ztp_A | 142 | Nucleoside diphosphate kinase; transferase; HET: G | 4e-88 | |
| 1k44_A | 136 | Nucleoside diphosphate kinase; nucleoside triphosp | 4e-87 | |
| 1xqi_A | 195 | Nucleoside diphosphate kinase; alpha/beta sandwich | 5e-77 |
| >1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 | Back alignment and structure |
|---|
Score = 293 bits (752), Expect = e-102
Identities = 138/179 (77%), Positives = 151/179 (84%), Gaps = 1/179 (0%)
Query: 62 SRSWLSGAIAIPA-AAYTLQEQEVHAAEMERTFIAIKPDGVQRGLISEIISRFERKGFKL 120
P Q AE+ERTFIAIKPDGVQRGLISEIISRFERKGFKL
Sbjct: 4 YHHHHHHDYDYPTTENLYFQGAMDPEAELERTFIAIKPDGVQRGLISEIISRFERKGFKL 63
Query: 121 VAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWEGEGVITYGRKLIGATD 180
V IK+++P+K+FAQ+HYHDLKERPFFNGLC+FLSSGPVIAMVWEGEGVITYGRKLIGATD
Sbjct: 64 VGIKVLIPTKQFAQQHYHDLKERPFFNGLCDFLSSGPVIAMVWEGEGVITYGRKLIGATD 123
Query: 181 PQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEDLVNYTSNAEKWVYESN 239
PQKS PGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPE+LV++TSN+EKW+Y N
Sbjct: 124 PQKSAPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEELVSFTSNSEKWIYGDN 182
|
| >3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 | Back alignment and structure |
|---|
| >4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 | Back alignment and structure |
|---|
| >1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 | Back alignment and structure |
|---|
| >3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 | Back alignment and structure |
|---|
| >3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 | Back alignment and structure |
|---|
| >3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 | Back alignment and structure |
|---|
| >3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 | Back alignment and structure |
|---|
| >1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 | Back alignment and structure |
|---|
| >3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 | Back alignment and structure |
|---|
| >1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 | Back alignment and structure |
|---|
| >2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 | Back alignment and structure |
|---|
| >1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 | Back alignment and structure |
|---|
| >1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 | Back alignment and structure |
|---|
| >1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 | Back alignment and structure |
|---|
| >2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 | Back alignment and structure |
|---|
| >3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 | Back alignment and structure |
|---|
| >3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 | Back alignment and structure |
|---|
| >1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 | Back alignment and structure |
|---|
| >2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 | Back alignment and structure |
|---|
| >1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 | Back alignment and structure |
|---|
| >2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 | Back alignment and structure |
|---|
| >1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 | Back alignment and structure |
|---|
| >3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 | Back alignment and structure |
|---|
| >4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 | Back alignment and structure |
|---|
| >4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 | Back alignment and structure |
|---|
| >3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 | Back alignment and structure |
|---|
| >1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 | Back alignment and structure |
|---|
| >1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 239 | |||
| 3q8u_A | 157 | Nucleoside diphosphate kinase; ferridoxin fold, al | 100.0 | |
| 4fkx_A | 161 | NDK B, nucleoside diphosphate kinase; structural g | 100.0 | |
| 3l7u_A | 172 | Nucleoside diphosphate kinase A; ATP-binding, nucl | 100.0 | |
| 3mpd_A | 151 | Nucleoside diphosphate kinase; ssgcid, NIH, niaid, | 100.0 | |
| 1w7w_A | 182 | Nucleoside diphosphate kinase; NDPK3, transferase; | 100.0 | |
| 2vu5_A | 148 | Nucleoside diphosphate kinase; nucleotide-binding, | 100.0 | |
| 3r9l_A | 155 | Nucleoside diphosphate kinase; structural genomics | 100.0 | |
| 1xiq_A | 157 | Nucleoside diphosphate kinase B; protein structure | 100.0 | |
| 1nb2_A | 150 | Nucleoside diphosphate kinase; bacillus halodenitr | 100.0 | |
| 1s57_A | 153 | Nucleoside diphosphate kinase II; transferase; HET | 100.0 | |
| 3bbb_A | 151 | Nucleoside diphosphate kinase B; transcription fac | 100.0 | |
| 1u8w_A | 149 | Nucleoside diphosphate kinase I; nucleotide diphos | 100.0 | |
| 3fkb_A | 155 | NDP kinase, NDK, nucleoside diphosphate kinase, cy | 100.0 | |
| 3js9_A | 156 | Nucleoside diphosphate kinase family protein; niai | 100.0 | |
| 1pku_A | 150 | Nucleoside diphosphate kinase I; RICE, transferase | 100.0 | |
| 3b54_A | 161 | NDK, NDP kinase, nucleoside diphosphate kinase; al | 100.0 | |
| 1zs6_A | 169 | Nucleoside diphosphate kinase 3; nucleotide metabo | 100.0 | |
| 2az3_A | 164 | Nucleoside diphosphate kinase; halophilic, transfe | 100.0 | |
| 4hr2_A | 145 | Nucleoside diphosphate kinase; ssgcid, seattle str | 100.0 | |
| 2dxe_A | 160 | Nucleoside diphosphate kinase; nucleoside binding, | 100.0 | |
| 4dz6_A | 190 | Nucleoside diphosphate kinase; ssgcid, niaid, vana | 100.0 | |
| 2hur_A | 142 | NDK, nucleoside diphosphate kinase, NDP kinase; ty | 100.0 | |
| 1nhk_R | 144 | Nucleoside diphosphate kinase; phosphotransferase; | 100.0 | |
| 3evo_A | 146 | NDP kinase, NDK, nucleoside diphosphate kinase; ph | 100.0 | |
| 1wkj_A | 137 | Nucleoside diphosphate kinase; thermus thermophilu | 100.0 | |
| 3ztp_A | 142 | Nucleoside diphosphate kinase; transferase; HET: G | 100.0 | |
| 1ehw_A | 162 | NDPK H4, nucleoside diphosphate kinase; NM23, mito | 100.0 | |
| 1k44_A | 136 | Nucleoside diphosphate kinase; nucleoside triphosp | 100.0 | |
| 1xqi_A | 195 | Nucleoside diphosphate kinase; alpha/beta sandwich | 100.0 | |
| 3bh7_B | 352 | Protein XRP2; protein-protein complex, GTPase acti | 99.97 |
| >3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-53 Score=357.86 Aligned_cols=149 Identities=52% Similarity=0.951 Sum_probs=147.3
Q ss_pred hceeEEEEcCcccccCcHHHHHHHHHHcCceEEeEEEeccCHHHHHHHhhhhcCCCChHHHHHHHccCcEEEEEEeecCH
Q 026399 89 MERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWEGEGV 168 (239)
Q Consensus 89 ~E~Tl~LIKPDav~~g~iG~II~~I~~~Gf~Iv~~Kmv~Ls~e~A~efY~~~~~k~~f~~Lv~~mtSGPvvaL~L~G~nA 168 (239)
+|+||+|||||++++|++|+||++|+++||+|+++||++||+++|++||.+|+++|||++|++||+||||++|+|+|+||
T Consensus 1 mErTl~iIKPDav~~~~~G~Ii~~ie~~Gf~Iv~~K~~~ls~e~a~~~Y~~h~~kpff~~Lv~~mtSGPvvamvleg~na 80 (157)
T 3q8u_A 1 MERTFLMIKPDAVQRNLIGEVISRIERKGLKLVGGKLMQVPMELAETHYGEHQGKPFYNDLISFITSAPVFAMVVEGEDA 80 (157)
T ss_dssp CCEEEEEECHHHHHTTCHHHHHHHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEESTTH
T ss_pred CceEEEEEChHHhhcCCHHHHHHHHHHCCCEEEEEEEecCCHHHHHHHHHHHCCCccHHHHHHHhcCCCEEEEEEeCCCH
Confidence 58999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhCCCCCCCCCCCCcccccccccCccEEEcCCChhhHHHHHhhcCCCCCccccccCCcccccc
Q 026399 169 ITYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEDLVNYTSNAEKWVYE 237 (239)
Q Consensus 169 V~~~R~LiGptdp~~a~P~sLRa~fG~~~~~NaVHgSDs~e~A~rEi~~FF~~~el~~~~~~~~~~~~~ 237 (239)
|+.||+++|||||.++.|+|||++||.+..+|+|||||++++|++||++||++.|+.+|.+..+.|+|.
T Consensus 81 V~~~R~l~GpTdp~~A~PgtIR~~fg~~~~~N~vHgSDs~esA~rEi~~fF~~~e~~~~~~~~~~~~~~ 149 (157)
T 3q8u_A 81 VNVSRHIIGSTNPSEASPGSIRGDLGLTVGRNIIHGSDSLESAEREINLWFNENEITSYASPRDAWLYE 149 (157)
T ss_dssp HHHHHHHHCCSSTTTSCTTSHHHHHCCBTTBCSEEECSSHHHHHHHHHHHCCGGGCCCCCCTTHHHHCC
T ss_pred HHHHHHHcCCCChhhcCCCChHHHhCCCCCCeeEEeCCCHHHHHHHHHHcCChHhhcccccchHHHHHH
Confidence 999999999999999999999999999999999999999999999999999999999999999999996
|
| >4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* | Back alignment and structure |
|---|
| >3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 | Back alignment and structure |
|---|
| >1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* | Back alignment and structure |
|---|
| >3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* | Back alignment and structure |
|---|
| >1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... | Back alignment and structure |
|---|
| >3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 | Back alignment and structure |
|---|
| >1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A | Back alignment and structure |
|---|
| >4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* | Back alignment and structure |
|---|
| >2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* | Back alignment and structure |
|---|
| >4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* | Back alignment and structure |
|---|
| >2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} | Back alignment and structure |
|---|
| >1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A | Back alignment and structure |
|---|
| >3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... | Back alignment and structure |
|---|
| >1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* | Back alignment and structure |
|---|
| >3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A | Back alignment and structure |
|---|
| >1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 | Back alignment and structure |
|---|
| >3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 239 | ||||
| d3bbba1 | 150 | d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, | 3e-66 | |
| d1s57a_ | 153 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 3e-65 | |
| d1w7wa_ | 151 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 7e-65 | |
| d1zs6a1 | 152 | d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, | 2e-63 | |
| d1xiqa_ | 149 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 1e-62 | |
| d1wkja1 | 137 | d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, | 3e-60 | |
| d2az3a1 | 152 | d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, | 5e-60 | |
| d1u8wa_ | 149 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 9e-59 | |
| d1hlwa_ | 150 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 2e-58 | |
| d1ehwa_ | 143 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 2e-57 | |
| d1xqia1 | 182 | d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, | 1e-56 | |
| d1nhkl_ | 143 | d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { | 1e-56 | |
| d1nb2a_ | 149 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 1e-56 | |
| d2dyaa1 | 153 | d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, | 9e-55 | |
| d1k44a_ | 135 | d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { | 9e-50 | |
| d2b8qa1 | 128 | d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, | 2e-42 |
| >d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: Nucleoside diphosphate kinase, NDK family: Nucleoside diphosphate kinase, NDK domain: Nucleoside diphosphate kinase, NDK species: Human (Homo sapiens) [TaxId: 9606]
Score = 200 bits (509), Expect = 3e-66
Identities = 94/150 (62%), Positives = 120/150 (80%)
Query: 87 AEMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFF 146
A +ERTFIAIKPDGVQRGL+ EII RFE+KGF+LVA+K + S+E ++HY DLK+RPFF
Sbjct: 1 ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFF 60
Query: 147 NGLCEFLSSGPVIAMVWEGEGVITYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSD 206
GL ++++SGPV+AMVWEG V+ GR ++G T+P S+PGTIRGD + VGRNIIHGSD
Sbjct: 61 PGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSD 120
Query: 207 GPETAKDEIKLWFKPEDLVNYTSNAEKWVY 236
++A+ EI LWFKPE+LV+Y S A WVY
Sbjct: 121 SVKSAEKEISLWFKPEELVDYKSCAHDWVY 150
|
| >d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 | Back information, alignment and structure |
|---|
| >d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 | Back information, alignment and structure |
|---|
| >d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 | Back information, alignment and structure |
|---|
| >d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 | Back information, alignment and structure |
|---|
| >d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 | Back information, alignment and structure |
|---|
| >d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 | Back information, alignment and structure |
|---|
| >d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 | Back information, alignment and structure |
|---|
| >d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 | Back information, alignment and structure |
|---|
| >d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 | Back information, alignment and structure |
|---|
| >d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 | Back information, alignment and structure |
|---|
| >d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 | Back information, alignment and structure |
|---|
| >d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 | Back information, alignment and structure |
|---|
| >d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 | Back information, alignment and structure |
|---|
| >d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 239 | |||
| d1w7wa_ | 151 | Nucleoside diphosphate kinase, NDK {Pea (Pisum sat | 100.0 | |
| d1nb2a_ | 149 | Nucleoside diphosphate kinase, NDK {Bacillus halod | 100.0 | |
| d3bbba1 | 150 | Nucleoside diphosphate kinase, NDK {Human (Homo sa | 100.0 | |
| d1zs6a1 | 152 | Nucleoside diphosphate kinase, NDK {Human(Homo sap | 100.0 | |
| d1s57a_ | 153 | Nucleoside diphosphate kinase, NDK {Thale cress (A | 100.0 | |
| d1xiqa_ | 149 | Nucleoside diphosphate kinase, NDK {Plasmodium fal | 100.0 | |
| d1u8wa_ | 149 | Nucleoside diphosphate kinase, NDK {Thale cress (A | 100.0 | |
| d2az3a1 | 152 | Nucleoside diphosphate kinase, NDK {Archaeon Halob | 100.0 | |
| d1ehwa_ | 143 | Nucleoside diphosphate kinase, NDK {Human (Homo sa | 100.0 | |
| d1hlwa_ | 150 | Nucleoside diphosphate kinase, NDK {Dictyostelium | 100.0 | |
| d2dyaa1 | 153 | Nucleoside diphosphate kinase, NDK {Archaeon Pyroc | 100.0 | |
| d1nhkl_ | 143 | Nucleoside diphosphate kinase, NDK {Myxococcus xan | 100.0 | |
| d1wkja1 | 137 | Nucleoside diphosphate kinase, NDK {Thermus thermo | 100.0 | |
| d1k44a_ | 135 | Nucleoside diphosphate kinase, NDK {Mycobacterium | 100.0 | |
| d1xqia1 | 182 | Nucleoside diphosphate kinase, NDK {Archaeon Pyrob | 100.0 | |
| d2b8qa1 | 128 | Nucleoside diphosphate kinase, NDK {Mimivirus [Tax | 100.0 |
| >d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: Nucleoside diphosphate kinase, NDK family: Nucleoside diphosphate kinase, NDK domain: Nucleoside diphosphate kinase, NDK species: Pea (Pisum sativum) [TaxId: 3888]
Probab=100.00 E-value=3.6e-54 Score=356.49 Aligned_cols=150 Identities=89% Similarity=1.479 Sum_probs=148.4
Q ss_pred hhceeEEEEcCcccccCcHHHHHHHHHHcCceEEeEEEeccCHHHHHHHhhhhcCCCChHHHHHHHccCcEEEEEEeecC
Q 026399 88 EMERTFIAIKPDGVQRGLISEIISRFERKGFKLVAIKIVVPSKEFAQKHYHDLKERPFFNGLCEFLSSGPVIAMVWEGEG 167 (239)
Q Consensus 88 ~~E~Tl~LIKPDav~~g~iG~II~~I~~~Gf~Iv~~Kmv~Ls~e~A~efY~~~~~k~~f~~Lv~~mtSGPvvaL~L~G~n 167 (239)
++|+||+|||||+++++++|+||++|+++||+|+++||++||+++|++||.+|+++|||+.|++||+||||++|+|+|+|
T Consensus 2 ~~E~Tl~iIKPdav~~~~~g~Ii~~i~~~Gf~Iv~~k~~~lt~e~a~~~Y~~~~~k~ff~~lv~~mtsGpv~al~l~g~n 81 (151)
T d1w7wa_ 2 ELERTFIAIKPDGVQRGLISEIISRFERKGFKLVGIKVLIPTKQFAQQHYHDLKERPFFNGLCDFLSSGPVIAMVWEGEG 81 (151)
T ss_dssp TTCEEEEEECHHHHHTTCHHHHHHHHHTTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEESTT
T ss_pred CcceEEEEECchhhhcCCHHHHHHHHHHCCCEEEEEEEEecCHHHHHHHHHHHHccccccchhhhccCCCEeeEeeccch
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhCCCCCCCCCCCCcccccccccCccEEEcCCChhhHHHHHhhcCCCCCccccccCCcccccc
Q 026399 168 VITYGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEDLVNYTSNAEKWVYE 237 (239)
Q Consensus 168 AV~~~R~LiGptdp~~a~P~sLRa~fG~~~~~NaVHgSDs~e~A~rEi~~FF~~~el~~~~~~~~~~~~~ 237 (239)
||+.||++||||||.++.|+|||++||.+.++|+|||||++++|++|+++|||++|+.+|.++.|.|+||
T Consensus 82 aV~~~r~l~Gptdp~~a~p~siR~~fg~~~~~N~vH~Sds~e~A~~Ei~~fF~~~ei~~~~~~~~~~~~~ 151 (151)
T d1w7wa_ 82 VITYGRKLIGATDPQKSAPGTIRGDLAVVVGRNIIHGSDGPETAKDEIKLWFKPEELVSFTSNSEKWIYG 151 (151)
T ss_dssp HHHHHHHHHCCSSGGGSCTTSHHHHHCCSGGGCCEEECCSHHHHHHHHHHHCCGGGCCCCCCTTHHHHTC
T ss_pred hHHHHHHHhccCCccccCCCchhHhhccccCCceeeCCCCHHHHHHHHHHccChhhceeccccCcccccC
Confidence 9999999999999999999999999999999999999999999999999999999999999999999997
|
| >d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} | Back information, alignment and structure |
|---|
| >d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} | Back information, alignment and structure |
|---|
| >d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} | Back information, alignment and structure |
|---|