Citrus Sinensis ID: 026413

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MAGLVPPGTTVKPDASTAKPKEEEKVDYMNLPCPIPYEEIHREALMSLKPELFEGLRFDFTKGLNQKFSLSHSVIMGPTEIPSQSTETIKIPTAHYEFGANYIDPKLMLIGRVLTDGRLNARVKCDLSDNLSLKANAQLTNEPHMSHGMINFDYKGKDYRTQFQFGNGALFGASYIQNVSPHLSLGGEVFWAGQHRKSGIGYAARYENDKMVMYFICVLHMMFAVIWSITPACVTSCRQ
cccccccccccccccccccccHHHHHccccccccccHHHHHHHHHHccccccccCEEEEEccccccccEEEEEEEEcccccccccccccccccccCEEEEEEEcccEEEEEEEcccccEEEEEEEEcccccEEEEEEEEccccccEEEEEEEEECcccCEEEEEECcccEEEEEEEEECcccCEEEEEEEECccccccEEEEEEEEEcccEEEEEEEEEccccEEEEEEcccEEEEccc
**************************DYMNLPCPIPYEEIHREALMSLKPELFEGLRFDFTKGLNQKFSLSHSVIMGPTEIPSQSTETIKIPTAHYEFGANYIDPKLMLIGRVLTDGRLNARVKCDLSDNLSLKANAQLT**PHMSHGMINFDYKGKDYRTQFQFGNGALFGASYIQNVSPHLSLGGEVFWAGQHRKSGIGYAARYENDKMVMYFICVLHMMFAVIWSITPACVTS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGLVPPGTTVKPDASTAKPKEEEKVDYMNLPCPIPYEEIHREALMSLKPELFEGLRFDFTKGLNQKFSLSHSVIMGPTEIPSQSTETIKIPTAHYEFGANYIDPKLMLIGRVLTDGRLNARVKCDLSDNLSLKANAQLTNEPHMSHGMINFDYKGKDYRTQFQFGNGALFGASYIQNVSPHLSLGGEVFWAGQHRKSGIGYAARYENDKMVMYFICVLHMMFAVIWSITPACVTSCRQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import receptor subunit TOM40-1 Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore. Directly involved in the pore formation.probableQ9LHE5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EMN, chain X
Confidence level:confident
Coverage over the Query: 31-80,92-230
View the alignment between query and template
View the model in PyMOL