Citrus Sinensis ID: 026414


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MSTEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDREFWSY
ccccccEEEEEHHHHcccccccEEEEEEEccccccEEEEEEEEEEcccccHHHHccccccccccEEccccccEEEEEEcccccccccccEEEEcccccccccccccccccccccccccccccccccccccccEEEccEEEEEEEccccccccEEEEccEEEEccccccccEEEEEccccccccHHEEEEcccccccEEEEEcccHHHHHHHHHHHHcccccEEEEccccccHHHHcccc
cccccccEEEEEEEEcccccccEEEEEEEccccccEEEEEEEEEEEcHHHHHHHHcccccccccEccccEEEEEEEEEcccccccccccEEEEcccccccccHHHHccccccccccHHHHHcccccccccccEEEccEEEEccccccccEcEEEEEHHHEEEccccccHHHHHHHHcHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHcc
MSTEGQVITCKAavawepnkplviedvqvappqagEVRIKILFTALChtdaytwsgkdpeglfpcilgheAAGIVesvgegvtevqpgdhvipcyqaecreckfcksgktnlcgkvrgatgagvmmndrksrfsingkpiyhfmgtstfsQYTVVHdvsvakidpqapldkvcllgcgvptglgavwntakvepgsivAVFGLGTVGLAVAEGAKaagasrvigididpkkfdrefwsy
mstegqvitckaavawepnkpLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFcksgktnlcgkvrgatgagvmmndRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAkaagasrvigididpkkfdrefwsy
MSTEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVglavaegakaagaSRVIGIDIDPKKFDREFWSY
******VITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFD******
**TEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDREFWSY
MSTEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDREFWSY
****GQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDREFWS*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDREFWSY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query239 2.2.26 [Sep-21-2011]
A2XAZ3 381 Alcohol dehydrogenase cla N/A no 0.970 0.608 0.935 1e-126
Q0DWH1 381 Alcohol dehydrogenase cla yes no 0.970 0.608 0.931 1e-126
Q96533 379 Alcohol dehydrogenase cla yes no 0.974 0.614 0.927 1e-126
P93629 381 Alcohol dehydrogenase cla N/A no 0.966 0.606 0.939 1e-126
P80572 378 Alcohol dehydrogenase cla N/A no 0.970 0.613 0.887 1e-118
P79896 376 Alcohol dehydrogenase cla N/A no 0.983 0.625 0.668 3e-88
P12711 374 Alcohol dehydrogenase cla yes no 0.953 0.609 0.711 2e-87
P00333 379 Alcohol dehydrogenase 1 O N/A no 0.987 0.622 0.659 3e-87
P81600 375 Alcohol dehydrogenase cla N/A no 0.970 0.618 0.669 3e-87
P14674 380 Alcohol dehydrogenase 2 O N/A no 0.974 0.613 0.656 4e-87
>sp|A2XAZ3|ADHX_ORYSI Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. indica GN=ADHIII PE=3 SV=1 Back     alignment and function desciption
 Score =  452 bits (1162), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 217/232 (93%), Positives = 224/232 (96%)

Query: 2   STEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEG 61
           ST+GQVITCKAAVAWE NKP+ IEDVQVAPPQAGEVR+KILFTALCHTD YTWSGKDPEG
Sbjct: 4   STQGQVITCKAAVAWEANKPMTIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKDPEG 63

Query: 62  LFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATG 121
           LFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVR ATG
Sbjct: 64  LFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRAATG 123

Query: 122 AGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPT 181
            GVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKI+PQAPLDKVCLLGCGV T
Sbjct: 124 VGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKINPQAPLDKVCLLGCGVST 183

Query: 182 GLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFD 233
           GLGAVWNTAKVE GSIVA+FGLGTVGLAVAEGAK+AGASR+IGIDID KKFD
Sbjct: 184 GLGAVWNTAKVEAGSIVAIFGLGTVGLAVAEGAKSAGASRIIGIDIDSKKFD 235





Oryza sativa subsp. indica (taxid: 39946)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 8EC: 4
>sp|Q0DWH1|ADHX_ORYSJ Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. japonica GN=Os02g0815500 PE=2 SV=1 Back     alignment and function description
>sp|Q96533|ADHX_ARATH Alcohol dehydrogenase class-3 OS=Arabidopsis thaliana GN=ADH2 PE=1 SV=2 Back     alignment and function description
>sp|P93629|ADHX_MAIZE Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH PE=2 SV=1 Back     alignment and function description
>sp|P80572|ADHX_PEA Alcohol dehydrogenase class-3 OS=Pisum sativum PE=1 SV=1 Back     alignment and function description
>sp|P79896|ADHX_SPAAU Alcohol dehydrogenase class-3 OS=Sparus aurata PE=2 SV=1 Back     alignment and function description
>sp|P12711|ADHX_RAT Alcohol dehydrogenase class-3 OS=Rattus norvegicus GN=Adh5 PE=1 SV=2 Back     alignment and function description
>sp|P00333|ADH1_MAIZE Alcohol dehydrogenase 1 OS=Zea mays GN=ADH1 PE=2 SV=1 Back     alignment and function description
>sp|P81600|ADHH_GADMO Alcohol dehydrogenase class-3 chain H OS=Gadus morhua PE=1 SV=1 Back     alignment and function description
>sp|P14674|ADH2_SOLTU Alcohol dehydrogenase 2 OS=Solanum tuberosum GN=ADH2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query239
353703786 379 alcohol dehydrogenase class III [Solanum 0.979 0.617 0.948 1e-128
433286663 396 Chain A, Crystal Structure Of S-nitrosog 0.974 0.588 0.948 1e-128
449487339 349 PREDICTED: alcohol dehydrogenase class-3 0.974 0.667 0.944 1e-126
449445644 379 PREDICTED: alcohol dehydrogenase class-3 0.974 0.614 0.944 1e-126
255585914 379 alcohol dehydrogenase, putative [Ricinus 0.979 0.617 0.935 1e-126
429840534 378 alcohol dehydrogenase 2 [Diospyros kaki] 0.974 0.616 0.939 1e-125
224065517 379 glutathione-dependent formaldehyde dehyd 0.979 0.617 0.931 1e-125
82400134 379 alcohol dehydrogenase class III-like pro 0.979 0.617 0.927 1e-125
238069187 374 S-nitrosoglutathione reductase [Brassica 0.974 0.622 0.931 1e-125
148886774 381 RecName: Full=Alcohol dehydrogenase clas 0.970 0.608 0.935 1e-125
>gi|353703786|ref|NP_001238796.1| alcohol dehydrogenase class III [Solanum lycopersicum] gi|283825505|gb|ADB43258.1| alcohol dehydrogenase class III [Solanum lycopersicum] gi|322719690|gb|ADX07743.1| alcohol dehydrogenase class III [Solanum habrochaites] gi|322719692|gb|ADX07744.1| alcohol dehydrogenase class III [Solanum chmielewskii] Back     alignment and taxonomy information
 Score =  463 bits (1192), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 222/234 (94%), Positives = 230/234 (98%)

Query: 1   MSTEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPE 60
           M+T+GQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVR+K+L+TALCHTDAYTWSGKDPE
Sbjct: 1   MATQGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVKVLYTALCHTDAYTWSGKDPE 60

Query: 61  GLFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGAT 120
           GLFPC+LGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVR AT
Sbjct: 61  GLFPCVLGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRAAT 120

Query: 121 GAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVP 180
           G GVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDP APL+KVCLLGCGVP
Sbjct: 121 GVGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPVAPLEKVCLLGCGVP 180

Query: 181 TGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDR 234
           TGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASR+IGIDID KKFDR
Sbjct: 181 TGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRIIGIDIDSKKFDR 234




Source: Solanum lycopersicum

Species: Solanum lycopersicum

Genus: Solanum

Family: Solanaceae

Order: Solanales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|433286663|pdb|4DL9|A Chain A, Crystal Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) In Complex With Nad+ gi|433286664|pdb|4DL9|B Chain B, Crystal Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) In Complex With Nad+ gi|433286665|pdb|4DLA|A Chain A, Crystal Structure Of S-nitrosoglutathione Reductase Apoenzyme From Tomato (solanum Lycopersicum) gi|433286666|pdb|4DLA|B Chain B, Crystal Structure Of S-nitrosoglutathione Reductase Apoenzyme From Tomato (solanum Lycopersicum) gi|433286667|pdb|4DLB|A Chain A, Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) Crystallized In Presence Of Nadh And Glutathione gi|433286668|pdb|4DLB|B Chain B, Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) Crystallized In Presence Of Nadh And Glutathione Back     alignment and taxonomy information
>gi|449487339|ref|XP_004157577.1| PREDICTED: alcohol dehydrogenase class-3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449445644|ref|XP_004140582.1| PREDICTED: alcohol dehydrogenase class-3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255585914|ref|XP_002533630.1| alcohol dehydrogenase, putative [Ricinus communis] gi|223526488|gb|EEF28759.1| alcohol dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|429840534|gb|AGA15794.1| alcohol dehydrogenase 2 [Diospyros kaki] Back     alignment and taxonomy information
>gi|224065517|ref|XP_002301836.1| glutathione-dependent formaldehyde dehydrogenase [Populus trichocarpa] gi|222843562|gb|EEE81109.1| glutathione-dependent formaldehyde dehydrogenase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|82400134|gb|ABB72806.1| alcohol dehydrogenase class III-like protein [Solanum tuberosum] Back     alignment and taxonomy information
>gi|238069187|gb|ACR40091.1| S-nitrosoglutathione reductase [Brassica juncea] Back     alignment and taxonomy information
>gi|148886774|sp|A2XAZ3.1|ADHX_ORYSI RecName: Full=Alcohol dehydrogenase class-3; AltName: Full=Alcohol dehydrogenase class-III; AltName: Full=Glutathione-dependent formaldehyde dehydrogenase; Short=FALDH; Short=FDH; Short=GSH-FDH; AltName: Full=S-(hydroxymethyl)glutathione dehydrogenase gi|125541608|gb|EAY88003.1| hypothetical protein OsI_09425 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query239
RGD|2292706 374 Adh5 "alcohol dehydrogenase 5 0.945 0.604 0.678 6.2e-78
UNIPROTKB|P12711 374 Adh5 "Alcohol dehydrogenase cl 0.945 0.604 0.678 6.2e-78
ZFIN|ZDB-GENE-011003-1 376 adh5 "alcohol dehydrogenase 5" 0.970 0.617 0.635 1.6e-77
MGI|MGI:87929 374 Adh5 "alcohol dehydrogenase 5 0.945 0.604 0.669 3.4e-77
DICTYBASE|DDB_G0281865 379 adh5 "alcohol dehydrogenase, c 0.966 0.609 0.637 4.3e-77
UNIPROTKB|F1NI89 370 ADH5 "Uncharacterized protein" 0.941 0.608 0.672 4.3e-77
UNIPROTKB|F1NKS5 374 ADH5 "Uncharacterized protein" 0.941 0.601 0.672 4.3e-77
UNIPROTKB|F1NKS6 362 ADH5 "Uncharacterized protein" 0.941 0.621 0.672 4.3e-77
TAIR|locus:2025237 379 ADH1 "alcohol dehydrogenase 1" 0.987 0.622 0.613 7.1e-77
UNIPROTKB|F1PLM5 376 F1PLM5 "Uncharacterized protei 0.953 0.606 0.663 9e-77
RGD|2292706 Adh5 "alcohol dehydrogenase 5 (class III), chi polypeptide" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 784 (281.0 bits), Expect = 6.2e-78, P = 6.2e-78
 Identities = 154/227 (67%), Positives = 172/227 (75%)

Query:     6 QVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPC 65
             QVI CKAAVAWE  KPL IE+++VAPPQA EVRIKI+ TA+CHTDAYT SG DPEG FP 
Sbjct:     4 QVIRCKAAVAWEAGKPLSIEEIEVAPPQAHEVRIKIIATAVCHTDAYTLSGADPEGCFPV 63

Query:    66 ILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVM 125
             ILGHE AGIVESVGEGVT+++ GD VIP Y  +C ECKFC + KTNLC K+R   G G +
Sbjct:    64 ILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKG-L 122

Query:   126 MNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGA 185
             M D  SRF+  GKPI HFMGTSTFS+YTVV D+SVAKIDP APLDKVCLLGCG+ TG GA
Sbjct:   123 MPDGTSRFTCKGKPILHFMGTSTFSEYTVVADISVAKIDPSAPLDKVCLLGCGISTGYGA 182

Query:   186 VWNTAKVEPGSIVAVFGLGTVXXXXXXXXXXXXXSRVIGIDIDPKKF 232
               NTAKVEPGS  AVFGLG V             SR+IGIDI+  KF
Sbjct:   183 AVNTAKVEPGSTCAVFGLGGVGLAVIMGCKVAGASRIIGIDINKDKF 229




GO:0000166 "nucleotide binding" evidence=IEA
GO:0001523 "retinoid metabolic process" evidence=IEA;ISO
GO:0003016 "respiratory system process" evidence=IEA;ISO
GO:0004022 "alcohol dehydrogenase (NAD) activity" evidence=IEA;ISO;IDA
GO:0005504 "fatty acid binding" evidence=IEA;ISO
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005739 "mitochondrion" evidence=IEA;ISO
GO:0006068 "ethanol catabolic process" evidence=IDA
GO:0006069 "ethanol oxidation" evidence=IEA
GO:0007568 "aging" evidence=IEP
GO:0008270 "zinc ion binding" evidence=IEA;ISO
GO:0018119 "peptidyl-cysteine S-nitrosylation" evidence=IEA;ISO
GO:0018467 "formaldehyde dehydrogenase activity" evidence=IEA;ISO
GO:0032496 "response to lipopolysaccharide" evidence=IEA;ISO
GO:0042803 "protein homodimerization activity" evidence=IEA;ISO
GO:0045777 "positive regulation of blood pressure" evidence=IEA;ISO
GO:0046294 "formaldehyde catabolic process" evidence=IEA;ISO
GO:0051409 "response to nitrosative stress" evidence=IEA;ISO
GO:0051775 "response to redox state" evidence=IEA;ISO
GO:0051903 "S-(hydroxymethyl)glutathione dehydrogenase activity" evidence=IEA;ISO
GO:0055114 "oxidation-reduction process" evidence=ISO
UNIPROTKB|P12711 Adh5 "Alcohol dehydrogenase class-3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-011003-1 adh5 "alcohol dehydrogenase 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:87929 Adh5 "alcohol dehydrogenase 5 (class III), chi polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0281865 adh5 "alcohol dehydrogenase, class 3" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1NI89 ADH5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKS5 ADH5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NKS6 ADH5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TAIR|locus:2025237 ADH1 "alcohol dehydrogenase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1PLM5 F1PLM5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q96533ADHX_ARATH1, ., 1, ., 1, ., 2, 8, 40.92700.97480.6147yesno
P19854ADHX_HORSE1, ., 1, ., 1, ., 2, 8, 40.68550.95390.6096yesno
A2XAZ3ADHX_ORYSI1, ., 1, ., 1, ., 2, 8, 40.93530.97070.6089N/Ano
P12711ADHX_RAT1, ., 1, ., 1, ., 2, 8, 40.71170.95390.6096yesno
O74685FADH_PICPA1, ., 1, ., 1, ., -0.60170.96230.6068yesno
P78870FADH1_SCHPO1, ., 1, ., 1, ., -0.64060.96230.6084yesno
P93629ADHX_MAIZE1, ., 1, ., 1, ., 2, 8, 40.93930.96650.6062N/Ano
Q0DWH1ADHX_ORYSJ1, ., 1, ., 1, ., 2, 8, 40.93100.97070.6089yesno
P80572ADHX_PEA1, ., 1, ., 1, ., 2, 8, 40.88790.97070.6137N/Ano
O19053ADHX_RABIT1, ., 1, ., 1, ., 2, 8, 40.68990.95390.6096yesno
Q17335ADHX_CAEEL1, ., 1, ., 1, ., 2, 8, 40.65080.96650.6015yesno
Q3ZC42ADHX_BOVIN1, ., 1, ., 1, ., 2, 8, 40.68990.95390.6096yesno
P46415ADHX_DROME1, ., 1, ., 1, ., 2, 8, 40.67240.96650.6094yesno
P11766ADHX_HUMAN1, ., 1, ., 1, ., 2, 8, 40.68990.95390.6096yesno
P28474ADHX_MOUSE1, ., 1, ., 1, ., 2, 8, 40.70300.95390.6096yesno
Q54TC2ADHX_DICDI1, ., 1, ., 1, ., 2, 8, 40.67240.96650.6094yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.963
4th Layer1.1.1.10.946

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
cd08300 368 cd08300, alcohol_DH_class_III, class III alcohol d 1e-171
cd08301 369 cd08301, alcohol_DH_plants, Plant alcohol dehydrog 1e-148
cd08277 365 cd08277, liver_alcohol_DH_like, Liver alcohol dehy 1e-128
COG1062 366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases 1e-125
cd08299 373 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV 1e-121
TIGR02818 368 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutat 1e-120
PLN02740 381 PLN02740, PLN02740, Alcohol dehydrogenase-like 1e-117
cd05279 365 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and 1e-108
PLN02827 378 PLN02827, PLN02827, Alcohol dehydrogenase-like 1e-98
cd08279 363 cd08279, Zn_ADH_class_III, Class III alcohol dehyd 1e-96
TIGR03989 369 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 fa 1e-73
cd08278 365 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydro 8e-73
cd08281 371 cd08281, liver_ADH_like1, Zinc-dependent alcohol d 4e-69
COG1064 339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 9e-53
TIGR03451 358 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothi 1e-52
cd08263 367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the M 3e-52
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 6e-43
cd08259 332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 1e-39
COG1063 350 COG1063, Tdh, Threonine dehydrogenase and related 4e-38
cd08260 345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD 3e-37
cd08231 361 cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 6e-37
cd08254 338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 5e-35
cd05278 347 cd05278, FDH_like, Formaldehyde dehydrogenases 2e-34
cd08245 330 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD 3e-34
cd08297 341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 5e-32
cd08236 343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 6e-32
cd08234 334 cd08234, threonine_DH_like, L-threonine dehydrogen 6e-32
cd08261 337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 1e-31
cd05285 343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 4e-31
PRK13771 334 PRK13771, PRK13771, putative alcohol dehydrogenase 8e-31
cd08235 343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 2e-30
cd08239 339 cd08239, THR_DH_like, L-threonine dehydrogenase (T 3e-30
cd08233 351 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio 6e-30
cd08283 386 cd08283, FDH_like_1, Glutathione-dependent formald 9e-29
cd05284 340 cd05284, arabinose_DH_like, D-arabinose dehydrogen 5e-28
pfam08240108 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like 4e-27
cd08298 329 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CA 8e-27
cd08266 342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 1e-26
cd05283 337 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA 1e-26
cd08284 344 cd08284, FDH_like_2, Glutathione-dependent formald 1e-25
cd08240 350 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa 1e-25
cd05281 341 cd05281, TDH, Threonine dehydrogenase 5e-25
cd08286 345 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase 5e-25
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 7e-25
cd08285 351 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd 2e-22
cd08296 333 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases 2e-21
cd08282 375 cd08282, PFDH_like, Pseudomonas putida aldehyde-di 8e-21
PRK09422 338 PRK09422, PRK09422, ethanol-active dehydrogenase/a 9e-21
COG0604 326 COG0604, Qor, NADPH:quinone reductase and related 4e-19
PRK05396 341 PRK05396, tdh, L-threonine 3-dehydrogenase; Valida 9e-19
cd08232 339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 2e-18
cd08265 384 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD 3e-18
PRK10309 347 PRK10309, PRK10309, galactitol-1-phosphate dehydro 8e-18
cd08287 345 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase 1e-17
TIGR00692 340 TIGR00692, tdh, L-threonine 3-dehydrogenase 1e-17
TIGR03201 349 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1 2e-17
PRK10083 339 PRK10083, PRK10083, putative oxidoreductase; Provi 6e-17
cd08249 339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 5e-16
cd08241 323 cd08241, QOR1, Quinone oxidoreductase (QOR) 2e-15
cd08264 325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t 2e-15
cd05289 309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 1e-14
cd08268328 cd08268, MDR2, Medium chain dehydrogenases/reducta 3e-14
cd08269 312 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD 5e-14
PLN02586 360 PLN02586, PLN02586, probable cinnamyl alcohol dehy 8e-14
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 1e-13
TIGR02819 393 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenas 2e-13
cd08255 277 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro 6e-13
cd08243 320 cd08243, quinone_oxidoreductase_like_1, Quinone ox 2e-12
PLN02702 364 PLN02702, PLN02702, L-idonate 5-dehydrogenase 2e-12
cd08272326 cd08272, MDR6, Medium chain dehydrogenases/reducta 4e-12
cd08253 325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 7e-12
cd08230 355 cd08230, glucose_DH, Glucose dehydrogenase 1e-11
PLN02514 357 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase 2e-11
cd08256 350 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MD 2e-11
cd08262 341 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD 3e-11
cd08276 336 cd08276, MDR7, Medium chain dehydrogenases/reducta 6e-11
cd05282323 cd05282, ETR_like, 2-enoyl thioester reductase-lik 1e-10
cd08292324 cd08292, ETR_like_2, 2-enoyl thioester reductase ( 7e-10
cd08242 319 cd08242, MDR_like, Medium chain dehydrogenases/red 1e-09
PLN02178 375 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase 2e-09
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 5e-09
TIGR03366 280 TIGR03366, HpnZ_proposed, putative phosphonate cat 6e-09
PRK10754327 PRK10754, PRK10754, quinone oxidoreductase, NADPH- 2e-08
cd08275 337 cd08275, MDR3, Medium chain dehydrogenases/reducta 4e-08
cd05195293 cd05195, enoyl_red, enoyl reductase of polyketide 5e-08
PRK09880 343 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Pro 8e-08
cd08252 336 cd08252, AL_MDR, Arginate lyase and other MDR fami 2e-07
cd08271325 cd08271, MDR5, Medium chain dehydrogenases/reducta 2e-07
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 4e-07
cd08250329 cd08250, Mgc45594_like, Mgc45594 gene product and 5e-07
TIGR02822329 TIGR02822, adh_fam_2, zinc-binding alcohol dehydro 6e-07
cd08290 341 cd08290, ETR, 2-enoyl thioester reductase (ETR) 1e-06
cd08251303 cd08251, polyketide_synthase, polyketide synthase 3e-06
cd08246 393 cd08246, crotonyl_coA_red, crotonyl-CoA reductase 4e-06
PTZ00354334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi 2e-05
cd08273331 cd08273, MDR8, Medium chain dehydrogenases/reducta 2e-05
smart00829287 smart00829, PKS_ER, Enoylreductase 4e-05
TIGR01751 398 TIGR01751, crot-CoA-red, crotonyl-CoA reductase 6e-05
TIGR02817 336 TIGR02817, adh_fam_1, zinc-binding alcohol dehydro 6e-05
TIGR02824325 TIGR02824, quinone_pig3, putative NAD(P)H quinone 2e-04
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 3e-04
TIGR03026 409 TIGR03026, NDP-sugDHase, nucleotide sugar dehydrog 0.001
cd08291324 cd08291, ETR_like_1, 2-enoyl thioester reductase ( 0.002
COG0677 436 COG0677, WecC, UDP-N-acetyl-D-mannosaminuronate de 0.002
cd05280325 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ 0.003
cd05288 329 cd05288, PGDH, Prostaglandin dehydrogenases 0.004
>gnl|CDD|176260 cd08300, alcohol_DH_class_III, class III alcohol dehydrogenases Back     alignment and domain information
 Score =  476 bits (1228), Expect = e-171
 Identities = 178/231 (77%), Positives = 196/231 (84%), Gaps = 3/231 (1%)

Query: 8   ITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCIL 67
           ITCKAAVAWE  KPL IE+V+VAPP+AGEVRIKIL T +CHTDAYT SG DPEGLFP IL
Sbjct: 1   ITCKAAVAWEAGKPLSIEEVEVAPPKAGEVRIKILATGVCHTDAYTLSGADPEGLFPVIL 60

Query: 68  GHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMN 127
           GHE AGIVESVGEGVT V+PGDHVIP Y  EC ECKFCKSGKTNLC K+R   G G +M 
Sbjct: 61  GHEGAGIVESVGEGVTSVKPGDHVIPLYTPECGECKFCKSGKTNLCQKIRATQGKG-LMP 119

Query: 128 DRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLGAVW 187
           D  SRFS  GKPIYHFMGTSTFS+YTVV ++SVAKI+P+APLDKVCLLGCGV TG GAV 
Sbjct: 120 DGTSRFSCKGKPIYHFMGTSTFSEYTVVAEISVAKINPEAPLDKVCLLGCGVTTGYGAVL 179

Query: 188 NTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFD--REF 236
           NTAKVEPGS VAVFGLG VGLAV +GAKAAGASR+IGIDI+P KF+  ++F
Sbjct: 180 NTAKVEPGSTVAVFGLGAVGLAVIQGAKAAGASRIIGIDINPDKFELAKKF 230


Members identified as glutathione-dependent formaldehyde dehydrogenase(FDH), a member of the zinc dependent/medium chain alcohol dehydrogenase family. FDH converts formaldehyde and NAD(P) to formate and NAD(P)H. The initial step in this process the spontaneous formation of a S-(hydroxymethyl)glutathione adduct from formaldehyde and glutathione, followed by FDH-mediated oxidation (and detoxification) of the adduct to S-formylglutathione. MDH family uses NAD(H) as a cofactor in the interconversion of alcohols and aldehydes or ketones. Like many zinc-dependent alcohol dehydrogenases (ADH) of the medium chain alcohol dehydrogenase/reductase family (MDR), these FDHs form dimers, with 4 zinc ions per dimer. The medium chain alcohol dehydrogenase family (MDR) have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The N-terminal region typically has an all-beta catalytic domain. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which have a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site and a structural zinc in a lobe of the catalytic domain. NAD(H) binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. Length = 368

>gnl|CDD|176261 cd08301, alcohol_DH_plants, Plant alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|176259 cd08299, alcohol_DH_class_I_II_IV, class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|131865 TIGR02818, adh_III_F_hyde, S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|178341 PLN02740, PLN02740, Alcohol dehydrogenase-like Back     alignment and domain information
>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|215442 PLN02827, PLN02827, Alcohol dehydrogenase-like Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|188504 TIGR03989, Rxyl_3153, oxidoreductase, Rxyl_3153 family Back     alignment and domain information
>gnl|CDD|176239 cd08278, benzyl_alcohol_DH, Benzyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|132492 TIGR03451, mycoS_dep_FDH, S-(hydroxymethyl)mycothiol dehydrogenase Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain Back     alignment and domain information
>gnl|CDD|176258 cd08298, CAD2, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>gnl|CDD|176184 cd05281, TDH, Threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|176256 cd08296, CAD_like, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176242 cd08282, PFDH_like, Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>gnl|CDD|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|180054 PRK05396, tdh, L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|182371 PRK10309, PRK10309, galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176247 cd08287, FDH_like_ADH3, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|132245 TIGR03201, dearomat_had, 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|182229 PRK10083, PRK10083, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|166227 PLN02586, PLN02586, probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|234025 TIGR02819, fdhA_non_GSH, formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|215378 PLN02702, PLN02702, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|176192 cd08230, glucose_DH, Glucose dehydrogenase Back     alignment and domain information
>gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like Back     alignment and domain information
>gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>gnl|CDD|176204 cd08242, MDR_like, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|177834 PLN02178, PLN02178, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|132409 TIGR03366, HpnZ_proposed, putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information
>gnl|CDD|182130 PRK09880, PRK09880, L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members Back     alignment and domain information
>gnl|CDD|131869 TIGR02822, adh_fam_2, zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase Back     alignment and domain information
>gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase Back     alignment and domain information
>gnl|CDD|188164 TIGR01751, crot-CoA-red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|234024 TIGR02817, adh_fam_1, zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|234094 TIGR03026, NDP-sugDHase, nucleotide sugar dehydrogenase Back     alignment and domain information
>gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>gnl|CDD|223749 COG0677, WecC, UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 239
COG1064 339 AdhP Zn-dependent alcohol dehydrogenases [General 100.0
COG1062 366 AdhC Zn-dependent alcohol dehydrogenases, class II 100.0
KOG0022 375 consensus Alcohol dehydrogenase, class III [Second 100.0
KOG0023 360 consensus Alcohol dehydrogenase, class V [Secondar 100.0
KOG0024 354 consensus Sorbitol dehydrogenase [Secondary metabo 100.0
TIGR02818 368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 100.0
cd08301 369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 100.0
PLN02740 381 Alcohol dehydrogenase-like 100.0
cd08300 368 alcohol_DH_class_III class III alcohol dehydrogena 100.0
cd08281 371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 100.0
cd08277 365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 100.0
PLN02827 378 Alcohol dehydrogenase-like 100.0
cd08239 339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 100.0
TIGR03451 358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 100.0
TIGR02819 393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 100.0
PLN02586 360 probable cinnamyl alcohol dehydrogenase 100.0
COG1063 350 Tdh Threonine dehydrogenase and related Zn-depende 100.0
PRK09880 343 L-idonate 5-dehydrogenase; Provisional 100.0
cd08299 373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 100.0
TIGR02822 329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 100.0
cd08230 355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 100.0
PLN02514 357 cinnamyl-alcohol dehydrogenase 100.0
cd05279 365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 100.0
PLN02178 375 cinnamyl-alcohol dehydrogenase 100.0
COG0604 326 Qor NADPH:quinone reductase and related Zn-depende 100.0
TIGR03201 349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 100.0
cd08237 341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 100.0
PRK10309 347 galactitol-1-phosphate dehydrogenase; Provisional 100.0
cd08231 361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 100.0
PRK10083 339 putative oxidoreductase; Provisional 100.0
cd08278 365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 100.0
cd08296 333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 100.0
cd08285 351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 100.0
cd08233 351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 100.0
cd08283 386 FDH_like_1 Glutathione-dependent formaldehyde dehy 100.0
PRK13771 334 putative alcohol dehydrogenase; Provisional 99.97
cd08256 350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 99.97
cd08279 363 Zn_ADH_class_III Class III alcohol dehydrogenase. 99.97
cd05278 347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 99.97
cd08246 393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 99.97
cd05284 340 arabinose_DH_like D-arabinose dehydrogenase. This 99.97
cd08259 332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 99.97
cd08282 375 PFDH_like Pseudomonas putida aldehyde-dismutating 99.97
cd08286 345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 99.97
KOG1197 336 consensus Predicted quinone oxidoreductase [Energy 99.97
cd08240 350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 99.97
cd08260 345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 99.97
cd08284 344 FDH_like_2 Glutathione-dependent formaldehyde dehy 99.97
cd08238 410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 99.97
PRK09422 338 ethanol-active dehydrogenase/acetaldehyde-active r 99.97
TIGR01202 308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.97
TIGR01751 398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 99.97
cd08263 367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 99.97
PLN02702 364 L-idonate 5-dehydrogenase 99.97
cd08298 329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 99.97
cd05283 337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 99.97
KOG0025 354 consensus Zn2+-binding dehydrogenase (nuclear rece 99.97
cd08242 319 MDR_like Medium chain dehydrogenases/reductase (MD 99.97
cd08265 384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 99.96
cd08264 325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 99.96
cd08254 338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 99.96
cd08261 337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 99.96
cd08262 341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 99.96
cd08266 342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 99.96
cd08245 330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 99.96
PRK05396 341 tdh L-threonine 3-dehydrogenase; Validated 99.96
cd08287 345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 99.96
cd08235 343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 99.96
cd08234 334 threonine_DH_like L-threonine dehydrogenase. L-thr 99.96
cd08236 343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 99.96
cd05285 343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 99.96
cd08232 339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 99.96
cd08297 341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 99.96
cd08291 324 ETR_like_1 2-enoyl thioester reductase (ETR) like 99.96
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 99.95
cd08292 324 ETR_like_2 2-enoyl thioester reductase (ETR) like 99.95
cd05281 341 TDH Threonine dehydrogenase. L-threonine dehydroge 99.95
TIGR03366 280 HpnZ_proposed putative phosphonate catabolism asso 99.95
cd08274 350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 99.95
TIGR02817 336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 99.95
cd08293 345 PTGR2 Prostaglandin reductase. Prostaglandins and 99.94
TIGR00692 340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 99.94
cd08290 341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 99.94
PRK10754 327 quinone oxidoreductase, NADPH-dependent; Provision 99.94
cd08276 336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 99.94
cd08295 338 double_bond_reductase_like Arabidopsis alkenal dou 99.93
cd08248 350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 99.93
cd05280 325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 99.93
PTZ00354 334 alcohol dehydrogenase; Provisional 99.93
cd08294 329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.93
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 99.93
cd08250 329 Mgc45594_like Mgc45594 gene product and other MDR 99.93
PLN03154 348 putative allyl alcohol dehydrogenase; Provisional 99.93
cd08252 336 AL_MDR Arginate lyase and other MDR family members 99.93
cd08243 320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 99.93
TIGR02825 325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 99.93
cd08244 324 MDR_enoyl_red Possible enoyl reductase. Member ide 99.93
cd08249 339 enoyl_reductase_like enoyl_reductase_like. Member 99.93
cd08289 326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 99.93
cd08270 305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 99.92
cd08288 324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 99.92
TIGR02823 323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 99.92
cd08273 331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 99.92
cd08253 325 zeta_crystallin Zeta-crystallin with NADP-dependen 99.91
cd08247 352 AST1_like AST1 is a cytoplasmic protein associated 99.91
cd05276 323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 99.91
cd08271 325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 99.91
cd08272 326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 99.91
cd08269 312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 99.9
cd05282 323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 99.9
cd05286 320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 99.9
cd08268 328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 99.89
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 99.89
cd05289 309 MDR_like_2 alcohol dehydrogenase and quinone reduc 99.89
TIGR02824 325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 99.89
cd08267 319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 99.88
cd08251 303 polyketide_synthase polyketide synthase. Polyketid 99.88
cd05288 329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.87
KOG1198 347 consensus Zinc-binding oxidoreductase [Energy prod 99.87
cd08241 323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 99.87
cd08275 337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 99.85
cd05195 293 enoyl_red enoyl reductase of polyketide synthase. 99.85
COG2130 340 Putative NADP-dependent oxidoreductases [General f 99.83
smart00829 288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 99.83
cd08255 277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.73
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 99.57
KOG1196 343 consensus Predicted NAD-dependent oxidoreductase [ 99.57
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 97.55
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.16
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.01
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.98
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 96.96
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 96.92
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 96.53
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 96.26
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 96.14
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 96.1
TIGR00518 370 alaDH alanine dehydrogenase. The family of known L 95.93
COG0169 283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 95.84
PF1382323 ADH_N_assoc: Alcohol dehydrogenase GroES-associate 95.7
PRK12549 284 shikimate 5-dehydrogenase; Reviewed 95.67
PF01262 168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 95.66
PRK12550 272 shikimate 5-dehydrogenase; Reviewed 95.63
PRK08306 296 dipicolinate synthase subunit A; Reviewed 95.55
PLN02494 477 adenosylhomocysteinase 95.55
TIGR01809 282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.47
PRK00258 278 aroE shikimate 5-dehydrogenase; Reviewed 95.37
PRK11873 272 arsM arsenite S-adenosylmethyltransferase; Reviewe 95.35
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 95.31
PRK14027 283 quinate/shikimate dehydrogenase; Provisional 95.24
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 94.82
PRK08324 681 short chain dehydrogenase; Validated 94.78
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 94.5
PRK12548 289 shikimate 5-dehydrogenase; Provisional 94.47
PLN03209 576 translocon at the inner envelope of chloroplast su 94.34
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 94.25
PLN02780 320 ketoreductase/ oxidoreductase 94.01
PRK07831 262 short chain dehydrogenase; Provisional 93.9
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 93.76
PRK13940 414 glutamyl-tRNA reductase; Provisional 93.68
PRK05866 293 short chain dehydrogenase; Provisional 93.67
PRK12749 288 quinate/shikimate dehydrogenase; Reviewed 93.62
PTZ00075 476 Adenosylhomocysteinase; Provisional 93.52
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 93.43
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 93.34
PRK06196 315 oxidoreductase; Provisional 93.23
TIGR00507 270 aroE shikimate 5-dehydrogenase. This model finds p 93.11
PRK04148134 hypothetical protein; Provisional 93.03
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 92.72
PRK06197 306 short chain dehydrogenase; Provisional 92.7
cd01078 194 NAD_bind_H4MPT_DH NADP binding domain of methylene 92.16
PLN02520 529 bifunctional 3-dehydroquinate dehydratase/shikimat 91.96
PRK00377 198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 91.89
PLN02253 280 xanthoxin dehydrogenase 91.76
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 91.63
PLN00203 519 glutamyl-tRNA reductase 91.61
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 91.51
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 91.28
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 91.21
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 90.91
TIGR02964 246 xanthine_xdhC xanthine dehydrogenase accessory pro 90.84
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 90.67
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 90.58
PRK06484 520 short chain dehydrogenase; Validated 90.53
cd05211 217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 90.27
PRK06720 169 hypothetical protein; Provisional 90.02
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 90.01
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 89.9
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 89.78
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 89.77
PRK14982 340 acyl-ACP reductase; Provisional 89.66
TIGR02356 202 adenyl_thiF thiazole biosynthesis adenylyltransfer 89.39
COG0686 371 Ald Alanine dehydrogenase [Amino acid transport an 89.17
KOG1208 314 consensus Dehydrogenases with different specificit 89.11
PTZ00079 454 NADP-specific glutamate dehydrogenase; Provisional 89.1
PRK08328 231 hypothetical protein; Provisional 88.89
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 88.84
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 88.78
PLN02686 367 cinnamoyl-CoA reductase 88.69
PRK09310 477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 88.67
PLN02928 347 oxidoreductase family protein 88.4
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 88.1
KOG1014 312 consensus 17 beta-hydroxysteroid dehydrogenase typ 88.06
TIGR02355 240 moeB molybdopterin synthase sulfurylase MoeB. This 87.6
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 87.48
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 87.22
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 87.18
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 87.16
PRK10669558 putative cation:proton antiport protein; Provision 86.98
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 86.81
PRK07201 657 short chain dehydrogenase; Provisional 86.67
PRK06719 157 precorrin-2 dehydrogenase; Validated 86.64
PRK05855 582 short chain dehydrogenase; Validated 86.54
PRK14967 223 putative methyltransferase; Provisional 86.54
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 86.5
COG0334 411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 86.48
PRK08410 311 2-hydroxyacid dehydrogenase; Provisional 86.23
PRK13243 333 glyoxylate reductase; Reviewed 86.19
PRK07985 294 oxidoreductase; Provisional 86.03
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 85.86
KOG1201 300 consensus Hydroxysteroid 17-beta dehydrogenase 11 85.86
PRK05690 245 molybdopterin biosynthesis protein MoeB; Provision 85.71
PRK06128 300 oxidoreductase; Provisional 85.67
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 85.58
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 85.57
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 85.5
PRK06701 290 short chain dehydrogenase; Provisional 85.39
PRK07574 385 formate dehydrogenase; Provisional 85.3
KOG1210 331 consensus Predicted 3-ketosphinganine reductase [S 85.29
PRK06436 303 glycerate dehydrogenase; Provisional 85.15
COG0111 324 SerA Phosphoglycerate dehydrogenase and related de 85.05
TIGR02354 200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 85.01
PRK09496 453 trkA potassium transporter peripheral membrane com 84.99
PRK06932 314 glycerate dehydrogenase; Provisional 84.87
PRK12831 464 putative oxidoreductase; Provisional 84.8
PRK03562 621 glutathione-regulated potassium-efflux system prot 84.8
PRK12480 330 D-lactate dehydrogenase; Provisional 84.63
PRK15469 312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 84.61
PRK06487 317 glycerate dehydrogenase; Provisional 84.51
cd01076 227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 84.39
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 84.17
cd00757 228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 84.15
PRK00676 338 hemA glutamyl-tRNA reductase; Validated 84.08
PRK12814 652 putative NADPH-dependent glutamate synthase small 84.02
PLN03139 386 formate dehydrogenase; Provisional 83.99
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 83.97
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 83.96
PRK12810 471 gltD glutamate synthase subunit beta; Reviewed 83.94
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 83.9
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 83.89
PRK14031 444 glutamate dehydrogenase; Provisional 83.87
PRK00811 283 spermidine synthase; Provisional 83.8
PRK06141 314 ornithine cyclodeaminase; Validated 83.46
PRK07340 304 ornithine cyclodeaminase; Validated 83.37
cd05313 254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 83.36
PRK08618 325 ornithine cyclodeaminase; Validated 83.28
PRK03659 601 glutathione-regulated potassium-efflux system prot 83.22
PRK08644 212 thiamine biosynthesis protein ThiF; Provisional 83.11
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 83.09
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 82.94
PRK07364 415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 82.74
PRK08223 287 hypothetical protein; Validated 82.71
PRK13984 604 putative oxidoreductase; Provisional 82.57
PRK15116 268 sulfur acceptor protein CsdL; Provisional 82.39
cd01492 197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 82.31
TIGR02992 326 ectoine_eutC ectoine utilization protein EutC. Mem 82.17
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 82.15
PLN02695 370 GDP-D-mannose-3',5'-epimerase 81.87
PRK08291 330 ectoine utilization protein EutC; Validated 81.78
PRK14030 445 glutamate dehydrogenase; Provisional 81.78
TIGR01381 664 E1_like_apg7 E1-like protein-activating enzyme Gsa 81.77
PF00289110 CPSase_L_chain: Carbamoyl-phosphate synthase L cha 81.69
PRK08317 241 hypothetical protein; Provisional 81.62
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 81.58
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 81.25
TIGR01317 485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 81.22
PTZ00414100 10 kDa heat shock protein; Provisional 81.11
PRK04176 257 ribulose-1,5-biphosphate synthetase; Provisional 81.05
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 80.99
PRK12779 944 putative bifunctional glutamate synthase subunit b 80.79
COG1052 324 LdhA Lactate dehydrogenase and related dehydrogena 80.77
PLN02206 442 UDP-glucuronate decarboxylase 80.7
PLN02366 308 spermidine synthase 80.67
TIGR01316 449 gltA glutamate synthase (NADPH), homotetrameric. T 80.56
PLN02572 442 UDP-sulfoquinovose synthase 80.54
TIGR00292 254 thiazole biosynthesis enzyme. This enzyme is invol 80.41
PRK12770 352 putative glutamate synthase subunit beta; Provisio 80.38
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=1.1e-49  Score=343.52  Aligned_cols=208  Identities=38%  Similarity=0.540  Sum_probs=197.8

Q ss_pred             ccceeEEEEecCCCCeEEEeecCCCCCCCeEEEEEeEeeechhhhhhhcCCCCCCCCCeeeeeeEEEEEEEeCCCCCCCC
Q 026414            7 VITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVQ   86 (239)
Q Consensus         7 ~~~~~a~~~~~~~~~~~~~~~~~p~~~~~eVlVkv~~~~i~~~D~~~~~g~~~~~~~p~~~G~e~vG~Vv~vG~~v~~~~   86 (239)
                      +++|||+++++.+++++++|++.|+|+++||+|+|+++|||++|++.+.|.++...+|.++|||.+|+|+++|++|+.|+
T Consensus         1 ~~~mkA~~~~~~~~pl~i~e~~~p~p~~~eVlI~v~~~GVChsDlH~~~G~~~~~~~P~ipGHEivG~V~~vG~~V~~~k   80 (339)
T COG1064           1 MMTMKAAVLKKFGQPLEIEEVPVPEPGPGEVLIKVEACGVCHTDLHVAKGDWPVPKLPLIPGHEIVGTVVEVGEGVTGLK   80 (339)
T ss_pred             CcceEEEEEccCCCCceEEeccCCCCCCCeEEEEEEEEeecchhhhhhcCCCCCCCCCccCCcceEEEEEEecCCCccCC
Confidence            46899999999999999999999999999999999999999999999999998888999999999999999999999999


Q ss_pred             CCCEEee-cCccCCCCCccccCCCCCCCCCcCCCCCCceeccCCccccccCCcceeeecCCcceeeeEEEecceeEecCC
Q 026414           87 PGDHVIP-CYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDP  165 (239)
Q Consensus        87 ~Gd~V~~-~~~~~~~~c~~c~~~~~~~c~~~~~~~~~G~~~~~g~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~p~  165 (239)
                      +||||.+ +...+|++|.+|++++.+.|++...   .|+. .+|                  +|+||+++|+.+++++|+
T Consensus        81 ~GDrVgV~~~~~~Cg~C~~C~~G~E~~C~~~~~---~gy~-~~G------------------Gyaeyv~v~~~~~~~iP~  138 (339)
T COG1064          81 VGDRVGVGWLVISCGECEYCRSGNENLCPNQKI---TGYT-TDG------------------GYAEYVVVPARYVVKIPE  138 (339)
T ss_pred             CCCEEEecCccCCCCCCccccCcccccCCCccc---ccee-ecC------------------cceeEEEEchHHeEECCC
Confidence            9999999 9999999999999999999998665   5666 666                  999999999999999999


Q ss_pred             CCCchhhhhcccccchhhhhhhhhcCCCCCCEEEEEcCCHHHHHHHHHHHHcCCCeEEEEcCChhhHhhhhhc
Q 026414          166 QAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDREFWS  238 (239)
Q Consensus       166 ~~~~~~aa~l~~~~~ta~~~~~~~~~~~~g~~vlI~G~g~~g~~ai~~~~~~G~~~vv~~~~~~~~~~~~~~~  238 (239)
                      ++++++||.+.|+..|.|+++ ...+++||++|+|.|.|++|++|+|+|+++|+ +|++++++++|+++++++
T Consensus       139 ~~d~~~aApllCaGiT~y~al-k~~~~~pG~~V~I~G~GGlGh~avQ~Aka~ga-~Via~~~~~~K~e~a~~l  209 (339)
T COG1064         139 GLDLAEAAPLLCAGITTYRAL-KKANVKPGKWVAVVGAGGLGHMAVQYAKAMGA-EVIAITRSEEKLELAKKL  209 (339)
T ss_pred             CCChhhhhhhhcCeeeEeeeh-hhcCCCCCCEEEEECCcHHHHHHHHHHHHcCC-eEEEEeCChHHHHHHHHh
Confidence            999999999999999999987 56999999999999999999999999999997 999999999999998764



>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13823 ADH_N_assoc: Alcohol dehydrogenase GroES-associated; PDB: 2DPH_B Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01381 E1_like_apg7 E1-like protein-activating enzyme Gsa7p/Apg7p Back     alignment and domain information
>PF00289 CPSase_L_chain: Carbamoyl-phosphate synthase L chain, N-terminal domain; InterPro: IPR005481 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PTZ00414 10 kDa heat shock protein; Provisional Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
4dl9_A 396 Crystal Structure Of S-nitrosoglutathione Reductase 1e-122
3uko_A 378 Crystal Structure Of S-Nitrosoglutathione Reductase 1e-119
1mc5_A 374 Ternary Complex Of Human Glutathione-Dependent Form 1e-80
3qj5_A 374 S-Nitrosoglutathione Reductase (Gsnor) In Complex W 1e-80
1teh_A 373 Structure Of Human Liver Chichi Alcohol Dehydrogena 1e-80
2fzw_A 373 Structure Of The Binary Complex Of The E67l Mutant 1e-79
3cos_A 381 Crystal Structure Of Human Class Ii Alcohol Dehydro 1e-72
1cdo_A 374 Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Co 1e-69
1e3l_A 376 P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase 5e-65
1e3e_A 376 Mouse Class Ii Alcohol Dehydrogenase Complex With N 9e-64
1hdy_A 374 Three-Dimensional Structures Of Three Human Alcohol 2e-63
1p0c_A 373 Crystal Structure Of The Nadp(H)-Dependent Vertebra 4e-63
1hdx_A 374 Three-Dimensional Structures Of Three Human Alcohol 1e-62
1htb_A 374 Crystallization Of Human Beta3 Alcohol Dehydrogenas 1e-62
1hdz_A 374 Three-Dimensional Structures Of Three Human Alcohol 3e-62
1qlh_A 374 Horse Liver Alcohol Dehydrogenase Complexed To Nad 4e-62
1agn_A 373 X-Ray Structure Of Human Sigma Alcohol Dehydrogenas 5e-62
1ju9_A 374 Horse Liver Alcohol Dehydrogenase Val292ser Mutant 5e-62
6adh_A 374 Structure Of Triclinic Ternary Complex Of Horse Liv 6e-62
3oq6_A 374 Horse Liver Alcohol Dehydrogenase A317c Mutant Comp 6e-62
1n8k_A 374 Horse Liver Alcohol Dehydrogenase Val292thr Mutant 6e-62
1axe_A 374 Crystal Structure Of The Active-Site Mutant Phe93-> 9e-62
1d1t_A 373 Mutant Of Human Sigma Alcohol Dehydrogenase With Le 1e-61
1axg_A 374 Crystal Structure Of The Val203->ala Mutant Of Live 2e-61
1mgo_A 374 Horse Liver Alcohol Dehydrogenase Phe93ala Mutant L 2e-61
1qv6_A 374 Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG 2e-61
1a71_A 374 Ternary Complex Of An Active Site Double Mutant Of 3e-61
1ee2_B 373 The Structure Of Steroid-Active Alcohol Dehydrogena 6e-61
1ht0_A 374 Human Gamma-2 Alcohol Dehydrogense Length = 374 1e-60
1ee2_A 373 The Structure Of Steroid-Active Alcohol Dehydrogena 2e-60
1hso_A 374 Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 2e-60
1f8f_A 371 Crystal Structure Of Benzyl Alcohol Dehydrogenase F 2e-25
3two_A 348 The Crystal Structure Of Cad From Helicobacter Pylo 5e-16
1rjw_A 339 Crystal Structure Of Nad(+)-Dependent Alcohol Dehyd 5e-15
3pii_A 339 Crystal Structure Of Mutant Of Ht- Alcohol Dehydrog 8e-15
2h6e_A 344 Crystal Structure Of The D-Arabinose Dehydrogenase 8e-15
1llu_A 342 The Ternary Complex Of Pseudomonas Aeruginosa Alcoh 1e-14
3meq_A 365 Crystal Structure Of Alcohol Dehydrogenase From Bru 2e-14
3s1l_A 340 Crystal Structure Of Apo-Form Furx Length = 340 9e-14
4ilk_A 359 Crystal Structure Of Short Chain Alcohol Dehydrogen 1e-13
1h2b_A 359 Crystal Structure Of The Alcohol Dehydrogenase From 9e-13
2hcy_A 347 Yeast Alcohol Dehydrogenase I, Saccharomyces Cerevi 1e-12
1uuf_A 369 Crystal Structure Of A Zinc-Type Alcohol Dehydrogen 1e-12
2eih_A 343 Crystal Structure Of Nad-Dependent Alcohol Dehydrog 2e-11
1e3j_A 352 Ketose Reductase (Sorbitol Dehydrogenase) From Silv 8e-11
2xaa_A 345 Alcohol Dehydrogenase Adh-'a' From Rhodococcus Rube 2e-10
4eex_A 348 Crystal Structure Of Lactococcus Lactis Alcohol Deh 3e-10
4eez_A 348 Crystal Structure Of Lactococcus Lactis Alcohol Deh 4e-10
2eer_A 347 Structural Study Of Project Id St2577 From Sulfolob 7e-10
2dq4_A 343 Crystal Structure Of Threonine 3-Dehydrogenase Leng 8e-10
1vj0_A 380 Crystal Structure Of Alcohol Dehydrogenase (Tm0436) 1e-09
3gfb_A 350 L-Threonine Dehydrogenase (Tktdh) From The Hyperthe 6e-09
1r37_A 347 Alcohol Dehydrogenase From Sulfolobus Solfataricus 1e-08
1nto_A 347 N249y Mutant Of Alcohol Dehydrogenase From The Arch 1e-08
1jvb_A 347 Alcohol Dehydrogenase From The Archaeon Sulfolobus 1e-08
3i4c_A 347 Crystal Structure Of Sulfolobus Solfataricus Adh(Ss 1e-08
4a2c_A 346 Crystal Structure Of Galactitol-1-Phosphate Dehydro 4e-08
2dfv_A 347 Hyperthermophilic Threonine Dehydrogenase From Pyro 4e-08
2d8a_A 348 Crystal Structure Of Ph0655 From Pyrococcus Horikos 4e-08
4ej6_A 370 Crystal Structure Of A Putative Zinc-Binding Dehydr 4e-08
1pl7_A 356 Human Sorbitol Dehydrogenase (Apo) Length = 356 6e-08
1yqd_A 366 Sinapyl Alcohol Dehydrogenase Complexed With Nadp+ 8e-08
1pl6_A 356 Human SdhNADHINHIBITOR COMPLEX Length = 356 1e-07
3qe3_A 355 Sheep Liver Sorbitol Dehydrogenase Length = 355 2e-07
2cd9_A 366 Sulfolobus Solfataricus Glucose Dehydrogenase 1 - A 2e-07
2cdb_A 366 Sulfolobus Solfataricus Glucose Dehydrogenase 1 In 7e-07
1kol_A 398 Crystal Structure Of Formaldehyde Dehydrogenase Len 1e-06
1qor_A327 Crystal Structure Of Escherichia Coli Quinone Oxido 1e-05
1jqb_A 351 Alcohol Dehydrogenase From Clostridium Beijerinckii 3e-05
3jyl_A325 Crystal Structures Of Pseudomonas Syringae Pv. Toma 4e-05
3m6i_A 363 L-Arabinitol 4-Dehydrogenase Length = 363 4e-05
3fpl_A 351 Chimera Of Alcohol Dehydrogenase By Exchange Of The 4e-05
1ped_A 351 Bacterial Secondary Alcohol Dehydrogenase (Apo-Form 6e-05
2b5w_A 357 Crystal Structure Of D38c Glucose Dehydrogenase Mut 8e-05
2b83_A 351 A Single Amino Acid Substitution In The Clostridium 2e-04
3ftn_A 352 Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDRO 2e-04
2dph_A 398 Crystal Structure Of Formaldehyde Dismutase Length 3e-04
1wly_A333 Crystal Structure Of 2-haloacrylate Reductase Lengt 3e-04
1ykf_A 352 Nadp-Dependent Alcohol Dehydrogenase From Thermoana 3e-04
2nvb_A 352 Contribution Of Pro275 To The Thermostability Of Th 3e-04
3fsr_A 352 Chimera Of Alcohol Dehydrogenase By Exchange Of The 4e-04
3slk_A 795 Structure Of Ketoreductase And Enoylreductase Didom 8e-04
3gaz_A 343 Crystal Structure Of An Alcohol Dehydrogenase Super 9e-04
>pdb|4DL9|A Chain A, Crystal Structure Of S-nitrosoglutathione Reductase From Tomato (solanum Lycopersicum) In Complex With Nad+ Length = 396 Back     alignment and structure

Iteration: 1

Score = 434 bits (1116), Expect = e-122, Method: Compositional matrix adjust. Identities = 208/233 (89%), Positives = 216/233 (92%) Query: 2 STEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEG 61 +T+GQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVR+K+L+TALCHTDAYTWSGKDPEG Sbjct: 19 ATQGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRVKVLYTALCHTDAYTWSGKDPEG 78 Query: 62 LFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATG 121 LFPC+LGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVR ATG Sbjct: 79 LFPCVLGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRAATG 138 Query: 122 AGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPT 181 GVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDP APL+KVCLLGCGVPT Sbjct: 139 VGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPVAPLEKVCLLGCGVPT 198 Query: 182 GLGAVWNTAKVEPGSIVAVFGLGTVXXXXXXXXXXXXXSRVIGIDIDPKKFDR 234 GLGAVWNTAKVEPGSIVAVFGLGTV SR+IGIDID KKFDR Sbjct: 199 GLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRIIGIDIDSKKFDR 251
>pdb|3UKO|A Chain A, Crystal Structure Of S-Nitrosoglutathione Reductase From Arabidopsis Thaliana, Complex With Nadh Length = 378 Back     alignment and structure
>pdb|1MC5|A Chain A, Ternary Complex Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With S-(Hydroxymethyl)glutathione And Nadh Length = 374 Back     alignment and structure
>pdb|3QJ5|A Chain A, S-Nitrosoglutathione Reductase (Gsnor) In Complex With N6022 Length = 374 Back     alignment and structure
>pdb|1TEH|A Chain A, Structure Of Human Liver Chichi Alcohol Dehydrogenase (A Glutathione- Dependent Formaldehyde Dehydrogenase) Length = 373 Back     alignment and structure
>pdb|2FZW|A Chain A, Structure Of The Binary Complex Of The E67l Mutant Of Human Glutathione-Dependent Formaldehyde Dehydrogenase With Nad(H) Length = 373 Back     alignment and structure
>pdb|3COS|A Chain A, Crystal Structure Of Human Class Ii Alcohol Dehydrogenase (Adh4) In Complex With Nad And Zn Length = 381 Back     alignment and structure
>pdb|1CDO|A Chain A, Alcohol Dehydrogenase (E.C.1.1.1.1) (Ee Isozyme) Complexed With Nicotinamide Adenine Dinucleotide (Nad), And Zinc Length = 374 Back     alignment and structure
>pdb|1E3L|A Chain A, P47h Mutant Of Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 Back     alignment and structure
>pdb|1E3E|A Chain A, Mouse Class Ii Alcohol Dehydrogenase Complex With Nadh Length = 376 Back     alignment and structure
>pdb|1HDY|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1P0C|A Chain A, Crystal Structure Of The Nadp(H)-Dependent Vertebrate Alcohol Dehydrogenase (Adh8) Length = 373 Back     alignment and structure
>pdb|1HDX|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1HTB|A Chain A, Crystallization Of Human Beta3 Alcohol Dehydrogenase (10 MgML) IN 100 MM SODIUM PHOSPHATE (PH 7.5), 7.5 MM NAD+ And 1 Mm 4-Iodopyrazole At 25 C Length = 374 Back     alignment and structure
>pdb|1HDZ|A Chain A, Three-Dimensional Structures Of Three Human Alcohol Dehydrogenase Variants: Correlations With Their Functional Differences Length = 374 Back     alignment and structure
>pdb|1QLH|A Chain A, Horse Liver Alcohol Dehydrogenase Complexed To Nad Double Mutant Of Gly 293 Ala And Pro 295 Thr Length = 374 Back     alignment and structure
>pdb|1AGN|A Chain A, X-Ray Structure Of Human Sigma Alcohol Dehydrogenase Length = 373 Back     alignment and structure
>pdb|1JU9|A Chain A, Horse Liver Alcohol Dehydrogenase Val292ser Mutant Length = 374 Back     alignment and structure
>pdb|6ADH|A Chain A, Structure Of Triclinic Ternary Complex Of Horse Liver Alcohol Dehydrogenase At 2.9 Angstroms Resolution Length = 374 Back     alignment and structure
>pdb|3OQ6|A Chain A, Horse Liver Alcohol Dehydrogenase A317c Mutant Complexed With Nad+ And 2,3,4,5,6-Pentafluorobenzyl Alcohol Length = 374 Back     alignment and structure
>pdb|1N8K|A Chain A, Horse Liver Alcohol Dehydrogenase Val292thr Mutant Complexed To Nad+ And Pyrazole Length = 374 Back     alignment and structure
>pdb|1AXE|A Chain A, Crystal Structure Of The Active-Site Mutant Phe93->trp Of Horse Liver Alcohol Dehydrogenase In Complex With Nad And Inhibitor Trifluoroethanol Length = 374 Back     alignment and structure
>pdb|1D1T|A Chain A, Mutant Of Human Sigma Alcohol Dehydrogenase With Leucine At Position 141 Length = 373 Back     alignment and structure
>pdb|1AXG|A Chain A, Crystal Structure Of The Val203->ala Mutant Of Liver Alcohol Dehydrogenase Complexed With Cofactor Nad And Inhibitor Trifluoroethanol Solved To 2.5 Angstrom Resolution Length = 374 Back     alignment and structure
>pdb|1MGO|A Chain A, Horse Liver Alcohol Dehydrogenase Phe93ala Mutant Length = 374 Back     alignment and structure
>pdb|1QV6|A Chain A, Horse Liver Alcohol Dehydrogenase His51glnLYS228ARG MUTANT Complexed With Nad+ And 2,4-Difluorobenzyl Alcohol Length = 374 Back     alignment and structure
>pdb|1A71|A Chain A, Ternary Complex Of An Active Site Double Mutant Of Horse Liver Alcohol Dehydrogenase, Phe93>trp, Val203>ala With Nad And Trifluoroethanol Length = 374 Back     alignment and structure
>pdb|1EE2|B Chain B, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 Back     alignment and structure
>pdb|1HT0|A Chain A, Human Gamma-2 Alcohol Dehydrogense Length = 374 Back     alignment and structure
>pdb|1EE2|A Chain A, The Structure Of Steroid-Active Alcohol Dehydrogenase At 1.54 A Resolution Length = 373 Back     alignment and structure
>pdb|1HSO|A Chain A, Human Alpha Alcohol Dehydrogenase (Adh1a) Length = 374 Back     alignment and structure
>pdb|1F8F|A Chain A, Crystal Structure Of Benzyl Alcohol Dehydrogenase From Acinetobacter Calcoaceticus Length = 371 Back     alignment and structure
>pdb|3TWO|A Chain A, The Crystal Structure Of Cad From Helicobacter Pylori Complexed With Nadp(H) Length = 348 Back     alignment and structure
>pdb|1RJW|A Chain A, Crystal Structure Of Nad(+)-Dependent Alcohol Dehydrogenase From Bacillus Stearothermophilus Strain Lld-R Length = 339 Back     alignment and structure
>pdb|3PII|A Chain A, Crystal Structure Of Mutant Of Ht- Alcohol Dehydrogenase With Substrate Analogue Butyramide Length = 339 Back     alignment and structure
>pdb|2H6E|A Chain A, Crystal Structure Of The D-Arabinose Dehydrogenase From Sulfolobus Solfataricus Length = 344 Back     alignment and structure
>pdb|1LLU|A Chain A, The Ternary Complex Of Pseudomonas Aeruginosa Alcohol Dehydrogenase With Its Coenzyme And Weak Substrate Length = 342 Back     alignment and structure
>pdb|3MEQ|A Chain A, Crystal Structure Of Alcohol Dehydrogenase From Brucella Mel Length = 365 Back     alignment and structure
>pdb|3S1L|A Chain A, Crystal Structure Of Apo-Form Furx Length = 340 Back     alignment and structure
>pdb|4ILK|A Chain A, Crystal Structure Of Short Chain Alcohol Dehydrogenase (rspb) From E. Coli Cft073 (efi Target Efi-506413) Complexed With Cofactor Nadh Length = 359 Back     alignment and structure
>pdb|1H2B|A Chain A, Crystal Structure Of The Alcohol Dehydrogenase From The Hyperthermophilic Archaeon Aeropyrum Pernix At 1.65a Resolution Length = 359 Back     alignment and structure
>pdb|2HCY|A Chain A, Yeast Alcohol Dehydrogenase I, Saccharomyces Cerevisiae Fermentative Enzyme Length = 347 Back     alignment and structure
>pdb|1UUF|A Chain A, Crystal Structure Of A Zinc-Type Alcohol Dehydrogenase-Like Protein Yahk Length = 369 Back     alignment and structure
>pdb|2EIH|A Chain A, Crystal Structure Of Nad-Dependent Alcohol Dehydrogenase Length = 343 Back     alignment and structure
>pdb|1E3J|A Chain A, Ketose Reductase (Sorbitol Dehydrogenase) From Silverleaf Whitefly Length = 352 Back     alignment and structure
>pdb|2XAA|A Chain A, Alcohol Dehydrogenase Adh-'a' From Rhodococcus Ruber Dsm 44541 At Ph 8.5 In Complex With Nad And Butane-1,4-Diol Length = 345 Back     alignment and structure
>pdb|4EEX|A Chain A, Crystal Structure Of Lactococcus Lactis Alcohol Dehydrogenase Length = 348 Back     alignment and structure
>pdb|4EEZ|A Chain A, Crystal Structure Of Lactococcus Lactis Alcohol Dehydrogenase Variant Re1 Length = 348 Back     alignment and structure
>pdb|2EER|A Chain A, Structural Study Of Project Id St2577 From Sulfolobus Tokodaii Strain7 Length = 347 Back     alignment and structure
>pdb|2DQ4|A Chain A, Crystal Structure Of Threonine 3-Dehydrogenase Length = 343 Back     alignment and structure
>pdb|1VJ0|A Chain A, Crystal Structure Of Alcohol Dehydrogenase (Tm0436) From Thermotoga Maritima At 2.00 A Resolution Length = 380 Back     alignment and structure
>pdb|3GFB|A Chain A, L-Threonine Dehydrogenase (Tktdh) From The Hyperthermophilic Archaeon Thermococcus Kodakaraensis Length = 350 Back     alignment and structure
>pdb|1R37|A Chain A, Alcohol Dehydrogenase From Sulfolobus Solfataricus Complexed With Nad(H) And 2-Ethoxyethanol Length = 347 Back     alignment and structure
>pdb|1NTO|A Chain A, N249y Mutant Of Alcohol Dehydrogenase From The Archaeon Sulfolobus Solfataricus-Monoclinic Crystal Form Length = 347 Back     alignment and structure
>pdb|1JVB|A Chain A, Alcohol Dehydrogenase From The Archaeon Sulfolobus Solfataricus Length = 347 Back     alignment and structure
>pdb|3I4C|A Chain A, Crystal Structure Of Sulfolobus Solfataricus Adh(Ssadh) Double Mutant (W95l,N249y) Length = 347 Back     alignment and structure
>pdb|4A2C|A Chain A, Crystal Structure Of Galactitol-1-Phosphate Dehydrogenase From Escherichia Coli Length = 346 Back     alignment and structure
>pdb|2DFV|A Chain A, Hyperthermophilic Threonine Dehydrogenase From Pyrococcus Horikoshii Length = 347 Back     alignment and structure
>pdb|2D8A|A Chain A, Crystal Structure Of Ph0655 From Pyrococcus Horikoshii Ot3 Length = 348 Back     alignment and structure
>pdb|4EJ6|A Chain A, Crystal Structure Of A Putative Zinc-Binding Dehydrogenase (Target Psi-012003) From Sinorhizobium Meliloti 1021 Length = 370 Back     alignment and structure
>pdb|1PL7|A Chain A, Human Sorbitol Dehydrogenase (Apo) Length = 356 Back     alignment and structure
>pdb|1YQD|A Chain A, Sinapyl Alcohol Dehydrogenase Complexed With Nadp+ Length = 366 Back     alignment and structure
>pdb|1PL6|A Chain A, Human SdhNADHINHIBITOR COMPLEX Length = 356 Back     alignment and structure
>pdb|3QE3|A Chain A, Sheep Liver Sorbitol Dehydrogenase Length = 355 Back     alignment and structure
>pdb|2CD9|A Chain A, Sulfolobus Solfataricus Glucose Dehydrogenase 1 - Apo Form Length = 366 Back     alignment and structure
>pdb|2CDB|A Chain A, Sulfolobus Solfataricus Glucose Dehydrogenase 1 In Complex With Nadp And Glucose Length = 366 Back     alignment and structure
>pdb|1KOL|A Chain A, Crystal Structure Of Formaldehyde Dehydrogenase Length = 398 Back     alignment and structure
>pdb|1QOR|A Chain A, Crystal Structure Of Escherichia Coli Quinone Oxidoreductase Complexed With Nadph Length = 327 Back     alignment and structure
>pdb|1JQB|A Chain A, Alcohol Dehydrogenase From Clostridium Beijerinckii: Crystal Structure Of Mutant With Enhanced Thermal Stability Length = 351 Back     alignment and structure
>pdb|3JYL|A Chain A, Crystal Structures Of Pseudomonas Syringae Pv. Tomato Dc3000 Quinone Oxidoreductase Length = 325 Back     alignment and structure
>pdb|3M6I|A Chain A, L-Arabinitol 4-Dehydrogenase Length = 363 Back     alignment and structure
>pdb|3FPL|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of C. Beijerinckii Adh By T. Brockii Adh Length = 351 Back     alignment and structure
>pdb|1PED|A Chain A, Bacterial Secondary Alcohol Dehydrogenase (Apo-Form) Length = 351 Back     alignment and structure
>pdb|2B5W|A Chain A, Crystal Structure Of D38c Glucose Dehydrogenase Mutant From Haloferax Mediterranei Length = 357 Back     alignment and structure
>pdb|2B83|A Chain A, A Single Amino Acid Substitution In The Clostridium Beijerinckii Alcohol Dehydrogenase Is Critical For Thermostabilization Length = 351 Back     alignment and structure
>pdb|3FTN|A Chain A, Q165eS254K DOUBLE MUTANT CHIMERA OF ALCOHOL DEHYDROGENASE BY EXCHANGE Of The Cofactor Binding Domain Res 153-295 Of T. Brockii Adh By C. Beijerinckii Adh Length = 352 Back     alignment and structure
>pdb|2DPH|A Chain A, Crystal Structure Of Formaldehyde Dismutase Length = 398 Back     alignment and structure
>pdb|1WLY|A Chain A, Crystal Structure Of 2-haloacrylate Reductase Length = 333 Back     alignment and structure
>pdb|1YKF|A Chain A, Nadp-Dependent Alcohol Dehydrogenase From Thermoanaerobium Brockii Length = 352 Back     alignment and structure
>pdb|2NVB|A Chain A, Contribution Of Pro275 To The Thermostability Of The Alcohol Dehydrogenases (Adhs) Length = 352 Back     alignment and structure
>pdb|3FSR|A Chain A, Chimera Of Alcohol Dehydrogenase By Exchange Of The Cofactor Binding Domain Res 153-295 Of T. Brockii Adh By C. Beijerinckii Adh Length = 352 Back     alignment and structure
>pdb|3SLK|A Chain A, Structure Of Ketoreductase And Enoylreductase Didomain From Modular Polyketide Synthase Length = 795 Back     alignment and structure
>pdb|3GAZ|A Chain A, Crystal Structure Of An Alcohol Dehydrogenase Superfamily Protein From Novosphingobium Aromaticivorans Length = 343 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query239
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 1e-160
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 1e-159
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 1e-158
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 1e-158
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 1e-157
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 1e-138
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 1e-117
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 3e-61
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 1e-52
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 3e-46
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 3e-46
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 4e-46
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 6e-46
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 1e-44
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 2e-44
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 2e-43
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 3e-43
4a2c_A 346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 4e-43
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 2e-40
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 2e-39
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 1e-38
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 2e-38
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 7e-38
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 8e-38
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 5e-36
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 2e-29
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 5e-29
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 6e-29
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 3e-27
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 5e-27
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 3e-26
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 4e-24
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 8e-24
1zsy_A 357 Mitochondrial 2-enoyl thioester reductase; medium- 4e-22
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 5e-22
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 3e-21
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 1e-20
3gms_A 340 Putative NADPH:quinone reductase; structural genom 4e-18
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 2e-16
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 3e-16
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 3e-15
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 6e-15
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 8e-15
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 9e-15
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 2e-14
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 7e-14
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 1e-13
4eye_A 342 Probable oxidoreductase; structural genomics, niai 3e-13
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 5e-13
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 6e-13
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 1e-12
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 2e-11
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 4e-11
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 7e-11
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 2e-10
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 9e-10
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 2e-09
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 9e-09
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 2e-08
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 3e-06
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 6e-04
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 7e-04
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 Back     alignment and structure
 Score =  448 bits (1154), Expect = e-160
 Identities = 157/230 (68%), Positives = 181/230 (78%), Gaps = 1/230 (0%)

Query: 5   GQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFP 64
            +VI CKAAVAWE  KPL IE+++VAPP+A EVRIKI+ TA+CHTDAYT SG DPEG FP
Sbjct: 2   NEVIKCKAAVAWEAGKPLSIEEIEVAPPKAHEVRIKIIATAVCHTDAYTLSGADPEGCFP 61

Query: 65  CILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGV 124
            ILGH  AGIVESVGEGVT+++ GD VIP Y  +C ECKFC + KTNLC K+R   G G+
Sbjct: 62  VILGHLGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGL 121

Query: 125 MMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPTGLG 184
           M  D  SRF+  GK I H+MGTSTFS+YTVV D+SVAKIDP APLDKVCLLGCG+ TG G
Sbjct: 122 MP-DGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGYG 180

Query: 185 AVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDR 234
           A  NTAK+EPGS+ AVFGLG VGLAV  G K AGASR+IG+DI+  KF R
Sbjct: 181 AAVNTAKLEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDKFAR 230


>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 369 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Length = 366 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Length = 348 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Length = 357 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Length = 360 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Length = 144 Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Length = 141 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query239
3uko_A 378 Alcohol dehydrogenase class-3; alcohol dehydrogena 100.0
1p0f_A 373 NADP-dependent alcohol dehydrogenase; ADH topology 100.0
2fzw_A 373 Alcohol dehydrogenase class III CHI chain; S-nitro 100.0
1cdo_A 374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 100.0
1e3i_A 376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 100.0
2jhf_A 374 Alcohol dehydrogenase E chain; oxidoreductase, met 100.0
1f8f_A 371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 100.0
1h2b_A 359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 100.0
3two_A 348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 100.0
3s2e_A 340 Zinc-containing alcohol dehydrogenase superfamily; 100.0
4ej6_A 370 Putative zinc-binding dehydrogenase; structural ge 100.0
3m6i_A 363 L-arabinitol 4-dehydrogenase; medium chain dehydro 100.0
1piw_A 360 Hypothetical zinc-type alcohol dehydrogenase- like 100.0
3fpc_A 352 NADP-dependent alcohol dehydrogenase; oxydoreducta 100.0
3jv7_A 345 ADH-A; dehydrogenase, nucleotide binding, rossmann 100.0
1pl8_A 356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 100.0
2d8a_A 348 PH0655, probable L-threonine 3-dehydrogenase; pyro 100.0
4a2c_A 346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 100.0
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 100.0
1e3j_A 352 NADP(H)-dependent ketose reductase; oxidoreductase 100.0
2dq4_A 343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 100.0
2h6e_A 344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 100.0
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 100.0
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 100.0
2eih_A 343 Alcohol dehydrogenase; zinc ION binding protein, s 100.0
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 100.0
1vj0_A 380 Alcohol dehydrogenase, zinc-containing; TM0436, st 100.0
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 100.0
2dph_A 398 Formaldehyde dismutase; dismutation of aldehydes, 100.0
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 100.0
1kol_A 398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 100.0
2b5w_A 357 Glucose dehydrogenase; nucleotide binding motif, o 100.0
3uog_A 363 Alcohol dehydrogenase; structural genomics, protei 100.0
3ip1_A 404 Alcohol dehydrogenase, zinc-containing; structural 100.0
4eez_A 348 Alcohol dehydrogenase 1; site-saturation mutagenes 100.0
4a0s_A 447 Octenoyl-COA reductase/carboxylase; oxidoreductase 100.0
3goh_A 315 Alcohol dehydrogenase, zinc-containing; NP_718042. 100.0
3krt_A 456 Crotonyl COA reductase; structural genomics, prote 100.0
2cdc_A 366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 100.0
3gaz_A 343 Alcohol dehydrogenase superfamily protein; oxidore 100.0
4dup_A 353 Quinone oxidoreductase; PSI-biology, structural ge 100.0
4eye_A 342 Probable oxidoreductase; structural genomics, niai 100.0
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 100.0
3gqv_A 371 Enoyl reductase; medium-chain reductase (MDR super 100.0
3gms_A 340 Putative NADPH:quinone reductase; structural genom 100.0
3jyn_A 325 Quinone oxidoreductase; rossmann fold, protein-NAD 100.0
3tqh_A 321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 100.0
3fbg_A 346 Putative arginate lyase; structural genomics, unkn 100.0
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
4dvj_A 363 Putative zinc-dependent alcohol dehydrogenase Pro; 100.0
1zsy_A 357 Mitochondrial 2-enoyl thioester reductase; medium- 100.0
3pi7_A 349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 100.0
2j8z_A 354 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
4a27_A 349 Synaptic vesicle membrane protein VAT-1 homolog-L; 100.0
1gu7_A 364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 100.0
1qor_A 327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 100.0
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 100.0
2vn8_A 375 Reticulon-4-interacting protein 1; mitochondrion, 100.0
3nx4_A 324 Putative oxidoreductase; csgid, structural genomic 100.0
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 100.0
1tt7_A 330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 100.0
1xa0_A 328 Putative NADPH dependent oxidoreductases; structur 100.0
3iup_A 379 Putative NADPH:quinone oxidoreductase; YP_296108.1 100.0
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 99.98
2zb4_A 357 Prostaglandin reductase 2; rossmann fold, alternat 99.98
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 99.97
1v3u_A 333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 99.96
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 99.96
2j3h_A 345 NADP-dependent oxidoreductase P1; double bond redu 99.95
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.81
1pqw_A 198 Polyketide synthase; rossmann fold, dimer, structu 99.21
2yvl_A 248 TRMI protein, hypothetical protein; tRNA, methyltr 98.6
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.12
1pjc_A 361 Protein (L-alanine dehydrogenase); oxidoreductase, 96.93
1o54_A 277 SAM-dependent O-methyltransferase; TM0748, structu 96.88
1x13_A 401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 96.87
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 96.82
2vhw_A 377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 96.8
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.71
3p2y_A 381 Alanine dehydrogenase/pyridine nucleotide transhy; 96.66
4dio_A 405 NAD(P) transhydrogenase subunit alpha PART 1; stru 96.65
3ce6_A 494 Adenosylhomocysteinase; protein-substrate complex, 96.65
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 96.59
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 96.56
2b25_A 336 Hypothetical protein; structural genomics, methyl 96.44
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.01
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 95.78
3c85_A183 Putative glutathione-regulated potassium-efflux S 95.73
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.68
3jyo_A 283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 95.66
3mb5_A 255 SAM-dependent methyltransferase; RNA methyltransfe 95.62
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 95.61
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 95.6
1p91_A 269 Ribosomal RNA large subunit methyltransferase A; R 95.54
1i9g_A 280 Hypothetical protein RV2118C; mtase, adoMet, cryst 95.45
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 95.44
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 95.44
3fbt_A 282 Chorismate mutase and shikimate 5-dehydrogenase fu 95.41
1nyt_A 271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 95.34
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 95.32
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 95.32
2egg_A 297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 95.23
3fpf_A 298 Mtnas, putative uncharacterized protein; thermonic 95.15
2rir_A300 Dipicolinate synthase, A chain; structural genomic 95.12
3pwz_A 272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 95.12
2pwy_A 258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 95.09
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 95.08
3tnl_A 315 Shikimate dehydrogenase; structural genomics, cent 95.06
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 95.06
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 95.05
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 95.03
3t4e_A 312 Quinate/shikimate dehydrogenase; structural genomi 95.02
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.02
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 94.96
1npy_A 271 Hypothetical shikimate 5-dehydrogenase-like protei 94.94
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 94.85
3u62_A 253 Shikimate dehydrogenase; shikimate pathway, oxidor 94.82
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 94.8
3o8q_A 281 Shikimate 5-dehydrogenase I alpha; structural geno 94.79
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 94.71
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 94.7
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 94.69
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 94.69
4dqx_A 277 Probable oxidoreductase protein; structural genomi 94.68
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 94.63
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 94.59
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 94.58
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 94.55
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 94.53
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 94.49
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 94.47
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 94.41
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 94.37
3rih_A 293 Short chain dehydrogenase or reductase; structural 94.36
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 94.3
3cxt_A 291 Dehydrogenase with different specificities; rossma 94.29
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 94.23
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 94.22
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 94.21
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 94.2
1lu9_A 287 Methylene tetrahydromethanopterin dehydrogenase; a 94.14
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 94.14
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 94.13
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 94.1
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 94.07
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 94.0
1xhl_A 297 Short-chain dehydrogenase/reductase family member 93.98
1p77_A 272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 93.97
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 93.93
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 93.91
3don_A 277 Shikimate dehydrogenase; alpha-beta structure, ros 93.73
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 93.63
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 93.62
1jw9_B 249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 93.58
3phh_A 269 Shikimate dehydrogenase; shikimate pathway, helico 93.57
1vl6_A 388 Malate oxidoreductase; TM0542, NAD-dependent malic 93.5
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 93.4
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 93.35
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 93.21
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 93.16
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 93.14
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 93.14
2hk9_A 275 Shikimate dehydrogenase; shikimate pathway, drug d 93.03
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 93.0
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 92.93
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 92.93
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 92.89
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 92.87
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 92.82
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 92.71
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 92.66
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 92.66
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 92.64
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 92.47
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 92.45
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.43
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 92.42
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.28
1nvt_A 287 Shikimate 5'-dehydrogenase; structural genomics, P 92.27
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 92.26
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 92.12
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 92.06
3njr_A 204 Precorrin-6Y methylase; methyltransferase, decarbo 92.04
3e05_A 204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 92.03
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 91.96
2o7s_A 523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 91.96
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 91.88
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 91.68
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 91.62
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 91.62
2d5c_A 263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 91.51
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 91.49
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 91.35
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 90.83
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 90.83
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 90.78
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 90.7
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 90.67
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 90.6
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 90.56
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 90.55
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 90.49
3grz_A 205 L11 mtase, ribosomal protein L11 methyltransferase 90.43
1jg1_A 235 PIMT;, protein-L-isoaspartate O-methyltransferase; 90.41
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 90.35
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 90.34
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 90.21
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 90.19
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 90.19
3hm2_A 178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 90.15
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 90.13
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 89.99
2a9f_A 398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 89.84
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 89.77
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 89.74
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 89.52
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 89.48
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 89.38
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 89.29
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 89.25
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 89.21
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 89.11
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 88.87
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 88.86
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 88.86
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 88.79
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 88.76
1zud_1 251 Adenylyltransferase THIF; thiamin, thiazole, prote 88.7
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 88.6
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 88.55
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 88.52
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 88.5
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 88.47
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 88.47
2nac_A 393 NAD-dependent formate dehydrogenase; oxidoreductas 88.43
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 88.42
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 88.39
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 88.3
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 88.25
2vns_A 215 Metalloreductase steap3; metal-binding, transmembr 88.16
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 88.04
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 88.02
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 88.01
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 87.93
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 87.77
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 87.45
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 87.27
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 87.18
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 87.1
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 87.08
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 87.08
3l07_A285 Bifunctional protein fold; structural genomics, ID 87.01
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 86.96
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 86.85
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 86.74
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 86.71
2we8_A 386 Xanthine dehydrogenase; oxidoreductase; 2.30A {Myc 86.7
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 86.65
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 86.64
3aoe_E 419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 86.64
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 86.63
4huj_A 220 Uncharacterized protein; PSI-biology, nysgrc, stru 86.62
1fbn_A 230 MJ fibrillarin homologue; MJ proteins, ribosomal R 86.59
3rp8_A 407 Flavoprotein monooxygenase; FAD-binding protein, o 86.47
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 86.32
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 86.29
2yq5_A 343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 86.28
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 86.27
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 86.2
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 86.13
2i99_A 312 MU-crystallin homolog; thyroid hormine binding pro 86.0
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 85.97
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 85.91
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 85.81
2xdo_A 398 TETX2 protein; tetracycline degradation, tigecycli 85.63
1i1n_A 226 Protein-L-isoaspartate O-methyltransferase; S-aden 85.6
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 85.55
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 85.51
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 85.29
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 85.25
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 85.23
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 85.1
1omo_A 322 Alanine dehydrogenase; two-domain, beta-sandwich-d 85.05
1l3i_A 192 Precorrin-6Y methyltransferase/putative decarboxyl 84.94
2bry_A 497 NEDD9 interacting protein with calponin homology a 84.87
4f6c_A 427 AUSA reductase domain protein; thioester reductase 84.81
3ihm_A 430 Styrene monooxygenase A; rossman fold, anti-parall 84.79
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 84.78
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 84.78
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 84.76
4hy3_A 365 Phosphoglycerate oxidoreductase; PSI-biology, stru 84.72
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 84.69
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 84.68
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 84.68
2gpy_A 233 O-methyltransferase; structural genomics, PSI, pro 84.67
3h5n_A 353 MCCB protein; ubiquitin-activating enzyme, microci 84.62
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 84.61
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 84.44
3on5_A 362 BH1974 protein; structural genomics, joint center 84.39
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 84.34
3p2o_A285 Bifunctional protein fold; structural genomics, ce 84.2
2nyu_A 196 Putative ribosomal RNA methyltransferase 2; SAM, s 84.19
3eey_A 197 Putative rRNA methylase; rRNA methylation, S-adeno 84.14
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 84.04
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 84.02
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 83.97
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 83.79
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 83.58
1vbf_A 231 231AA long hypothetical protein-L-isoaspartate O- 83.31
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 83.24
1ryi_A 382 Glycine oxidase; flavoprotein, protein-inhibitor c 82.91
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 82.81
2r0c_A 549 REBC; flavin adenine dinucleotide, monooxygenase, 82.64
3mti_A 185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 82.06
3v76_A 417 Flavoprotein; structural genomics, PSI-biology, NE 82.06
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 81.98
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 81.94
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 81.89
3aog_A 440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 81.8
3itj_A 338 Thioredoxin reductase 1; disulfide B flavoprotein, 81.76
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 81.64
3kb6_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 81.6
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 81.27
2vdc_G 456 Glutamate synthase [NADPH] small chain; oxidoreduc 81.24
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 81.17
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 80.89
4fcc_A 450 Glutamate dehydrogenase; protein complex, rossmann 80.81
3vc1_A 312 Geranyl diphosphate 2-C-methyltransferase; rossman 80.78
3k92_A 424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 80.73
3vh1_A 598 Ubiquitin-like modifier-activating enzyme ATG7; au 80.57
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 80.42
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 80.41
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 80.1
1rp0_A 284 ARA6, thiazole biosynthetic enzyme; protein ligand 80.09
3fmw_A 570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 80.03
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
Probab=100.00  E-value=4.6e-47  Score=336.79  Aligned_cols=235  Identities=91%  Similarity=1.454  Sum_probs=215.7

Q ss_pred             CCcccceeEEEEecCCCCeEEEeecCCCCCCCeEEEEEeEeeechhhhhhhcCCCCCCCCCeeeeeeEEEEEEEeCCCCC
Q 026414            4 EGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVT   83 (239)
Q Consensus         4 ~~~~~~~~a~~~~~~~~~~~~~~~~~p~~~~~eVlVkv~~~~i~~~D~~~~~g~~~~~~~p~~~G~e~vG~Vv~vG~~v~   83 (239)
                      ...|++|||+++++++++++++|+|.|+|++|||||||++++||++|++.+.|..+...+|.++|||++|+|+++|++++
T Consensus         3 ~~~~~tmkA~v~~~~~~~l~~~~~~~p~~~~~eVlVkv~a~gi~~~D~~~~~g~~~~~~~P~v~GhE~~G~V~~vG~~v~   82 (378)
T 3uko_A            3 QGQVITCKAAVAYEPNKPLVIEDVQVAPPQAGEVRIKILYTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVT   82 (378)
T ss_dssp             TTSCEEEEEEEBCSTTSCCEEEEEEECCCCTTEEEEEEEEEEECHHHHHHHTTCCTTCCSSBCCCCEEEEEEEEECTTCC
T ss_pred             cccceeeEEEEEecCCCccEEEEecCCCCCCCeEEEEEEEeecCHHHHHHhcCCCCCCCCCccCCccceEEEEEeCCCCC
Confidence            36789999999999998999999999999999999999999999999999999877668899999999999999999999


Q ss_pred             CCCCCCEEeecCccCCCCCccccCCCCCCCCCcCCCCCCceeccCCccccccCCcceeeecCCcceeeeEEEecceeEec
Q 026414           84 EVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKI  163 (239)
Q Consensus        84 ~~~~Gd~V~~~~~~~~~~c~~c~~~~~~~c~~~~~~~~~G~~~~~g~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~  163 (239)
                      +|++||||++.+..+|+.|.+|++++.+.|.+.......|....+|...+..+|...++..+.|+|+||+++|.+.++++
T Consensus        83 ~~~vGdrV~~~~~~~Cg~C~~C~~g~~~~C~~~~~~~~~G~~~~~g~~~~~~~g~~~~~~~~~G~~aey~~v~~~~~~~i  162 (378)
T 3uko_A           83 EVQAGDHVIPCYQAECRECKFCKSGKTNLCGKVRSATGVGIMMNDRKSRFSVNGKPIYHFMGTSTFSQYTVVHDVSVAKI  162 (378)
T ss_dssp             SCCTTCEEEECSSCCCSSSHHHHHTSCSCCCSSHHHHTTTCCTTTSSCSEEETTEEEBCCTTTCCSBSEEEEEGGGEEEC
T ss_pred             cCCCCCEEEEecCCCCCCChhhhCcCcCcCcCcccccccccccccCccccccCCcccccccCCcceEeEEEechhheEEC
Confidence            99999999999999999999999999999998654333454445666667778888888888899999999999999999


Q ss_pred             CCCCCchhhhhcccccchhhhhhhhhcCCCCCCEEEEEcCCHHHHHHHHHHHHcCCCeEEEEcCChhhHhhhhhc
Q 026414          164 DPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVFGLGTVGLAVAEGAKAAGASRVIGIDIDPKKFDREFWS  238 (239)
Q Consensus       164 p~~~~~~~aa~l~~~~~ta~~~~~~~~~~~~g~~vlI~G~g~~g~~ai~~~~~~G~~~vv~~~~~~~~~~~~~~~  238 (239)
                      |+++++++|+.+++++.|||+++.+..++++|++|||+|+|++|++++|+|+++|+++|++++++++|+++++++
T Consensus       163 P~~~~~~~aa~l~~~~~ta~~al~~~~~~~~g~~VlV~GaG~vG~~a~q~a~~~Ga~~Vi~~~~~~~~~~~a~~l  237 (378)
T 3uko_A          163 DPTAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSNVAIFGLGTVGLAVAEGAKTAGASRIIGIDIDSKKYETAKKF  237 (378)
T ss_dssp             CTTSCHHHHGGGGTHHHHHHHHHHTTTCCCTTCCEEEECCSHHHHHHHHHHHHHTCSCEEEECSCTTHHHHHHTT
T ss_pred             CCCCCHHHhhhhhhhHHHHHHHHHhhcCCCCCCEEEEECCCHHHHHHHHHHHHcCCCeEEEEcCCHHHHHHHHHc
Confidence            999999999999999999999988899999999999999999999999999999998899999999999988753



>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2we8_A Xanthine dehydrogenase; oxidoreductase; 2.30A {Mycobacterium smegmatis} PDB: 2we7_A Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3on5_A BH1974 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, oxidoreductase; 2.80A {Bacillus halodurans} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 239
d1cdoa1199 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase 2e-51
d2fzwa1197 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase 3e-49
d1p0fa1198 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro 2e-45
d1e3ia1202 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase 3e-45
d2jhfa1198 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase 1e-43
d1f8fa1194 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr 1e-32
d1uufa1179 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein 1e-23
d1vj0a1184 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein 3e-23
d1llua1175 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase 1e-22
d1piwa1192 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy 6e-22
d1d1ta2 176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 5e-19
d1e3ja1178 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor 2e-17
d1jvba1177 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase 2e-17
d1e3ia2 174 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( 3e-17
d1kola1201 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog 9e-17
d1rjwa1171 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase 3e-15
d1p0fa2 174 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog 3e-15
d1pl8a1185 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sor 1e-13
d1h2ba1171 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenas 1e-13
d2jhfa2 176 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( 3e-13
d2fzwa2 176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 8e-12
d1jqba1177 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secon 2e-11
d1cdoa2 175 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga 7e-11
d1f8fa2 174 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { 1e-10
d1yb5a1150 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductas 5e-07
d1iz0a1131 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase 1e-06
d1jqba2 174 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol 8e-06
d1vj0a2 182 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T 1e-05
d1xa0a1152 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homo 2e-05
d1gu7a1175 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA redu 6e-05
d1kola2 195 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Ps 1e-04
d1mv8a2 202 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pse 3e-04
d1dlja2 196 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGD 7e-04
d1qora1147 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductas 8e-04
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 Back     information, alignment and structure

class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Alcohol dehydrogenase
species: Cod (Gadus callarias) [TaxId: 8053]
 Score =  163 bits (414), Expect = 2e-51
 Identities = 95/200 (47%), Positives = 129/200 (64%), Gaps = 1/200 (0%)

Query: 2   STEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEG 61
           +T G+VI CKAAVAWE NKPLVIE+++V  P A E+RIKI+ T +CHTD Y       + 
Sbjct: 1   ATVGKVIKCKAAVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLYHLFEGKHKD 60

Query: 62  LFPCILGHEAAGIVESVGEGVTEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATG 121
            FP +LGHE AGIVESVG GVTE QPG+ VIP + ++C EC+FC+S KTN C K   A  
Sbjct: 61  GFPVVLGHEGAGIVESVGPGVTEFQPGEKVIPLFISQCGECRFCQSPKTNQCVKGW-ANE 119

Query: 122 AGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAKIDPQAPLDKVCLLGCGVPT 181
           +  +M+ +++RF+  G+ +  F+GTSTFSQYTVV+ ++VAKIDP   LD+       + +
Sbjct: 120 SPDVMSPKETRFTCKGRKVLQFLGTSTFSQYTVVNQIAVAKIDPSVKLDEFITHRMPLES 179

Query: 182 GLGAVWNTAKVEPGSIVAVF 201
              A+      +    V   
Sbjct: 180 VNDAIDLMKHGKCIRTVLSL 199


>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 198 Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 184 Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 177 Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 171 Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 177 Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 131 Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 174 Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 152 Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 175 Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 195 Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 202 Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Length = 196 Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 147 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query239
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 100.0
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 100.0
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 100.0
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 100.0
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 100.0
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 100.0
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 100.0
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 100.0
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 100.0
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 100.0
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 100.0
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 100.0
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 100.0
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 100.0
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 100.0
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 100.0
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 99.98
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.97
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.96
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.95
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 99.95
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.92
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.92
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 99.91
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 99.63
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.63
d1p0fa2 174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.45
d1e3ia2 174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.44
d2fzwa2 176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.44
d1d1ta2 176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.43
d1yb5a2 174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.4
d2jhfa2 176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.38
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.37
d1qora2 179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.37
d1jqba2 174 Bacterial secondary alcohol dehydrogenase {Clostri 99.35
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.34
d1f8fa2 174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.34
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.32
d1cdoa2 175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.32
d1vj0a2 182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.32
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.3
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 99.29
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.27
d1pqwa_ 183 Putative enoyl reductase domain of polyketide synt 99.25
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.23
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.21
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.2
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.19
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.18
d1v3va2 182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.15
d1kola2 195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.13
d1gu7a2 189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.12
d1o89a2 177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.04
d1vj1a2 187 Putative zinc-binding alcohol dehydrogenase {Mouse 98.97
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 98.75
d1l7da1 183 Nicotinamide nucleotide transhydrogenase dI compon 97.08
d1npya1 167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.04
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.97
d1nyta1 170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.69
d1luaa1 191 Methylene-tetrahydromethanopterin dehydrogenase {M 96.54
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 95.98
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.87
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 95.83
d1vi2a1 182 Putative shikimate dehydrogenase YdiB {Escherichia 95.83
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 95.61
d1p77a1 171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.53
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 95.01
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 94.82
d1nvta1 177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.43
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.29
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.28
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 93.84
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 93.76
d1djqa3 233 Trimethylamine dehydrogenase, middle domain {Methy 93.45
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 93.45
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 93.33
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 93.28
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.11
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 92.76
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.74
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 92.63
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 92.51
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 92.26
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 92.01
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 91.96
d1j4aa1 197 D-lactate dehydrogenase {Lactobacillus helveticus 91.92
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 91.53
d1pjza_ 201 Thiopurine S-methyltransferase {Pseudomonas syring 91.49
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 91.48
d1dxya1 199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 91.47
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 91.46
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 91.3
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 91.1
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.1
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 91.02
d1yb2a1 250 Hypothetical protein Ta0852 {Thermoplasma acidophi 90.9
d1mx3a1 193 Transcription corepressor CtbP {Human (Homo sapien 90.82
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 90.17
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 89.68
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 89.54
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 89.36
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 89.32
d1vbfa_ 224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 89.09
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 89.02
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 88.98
d1jw9b_ 247 Molybdenum cofactor biosynthesis protein MoeB {Esc 88.51
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 88.45
d1o54a_ 266 Hypothetical protein TM0748 {Thermotoga maritima [ 88.29
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 87.75
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 87.22
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 87.2
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 86.66
d1gdha1 191 D-glycerate dehydrogenase {Hyphomicrobium methylov 86.48
d1sc6a1 188 Phosphoglycerate dehydrogenase {Escherichia coli [ 85.47
d1i1na_ 224 Protein-L-isoaspartyl O-methyltransferase {Human ( 85.36
d2bzga1 229 Thiopurine S-methyltransferase {Human (Homo sapien 85.24
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 84.89
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 84.79
d2naca1 188 Formate dehydrogenase {Pseudomonas sp., strain 101 84.26
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 84.08
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 83.99
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 83.66
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 83.34
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 83.07
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 82.69
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 82.64
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 82.61
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 82.0
d1vl6a1 222 Malate oxidoreductase (malic enzyme) {Thermotoga m 81.48
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 81.44
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 81.34
d1nw3a_ 328 Catalytic, N-terminal domain of histone methyltran 81.01
d1rp0a1 278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 80.94
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 80.25
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 80.15
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Alcohol dehydrogenase
species: Cod (Gadus callarias) [TaxId: 8053]
Probab=100.00  E-value=3.3e-40  Score=266.72  Aligned_cols=198  Identities=48%  Similarity=0.776  Sum_probs=183.1

Q ss_pred             CCCcccceeEEEEecCCCCeEEEeecCCCCCCCeEEEEEeEeeechhhhhhhcCCCCCCCCCeeeeeeEEEEEEEeCCCC
Q 026414            3 TEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGV   82 (239)
Q Consensus         3 ~~~~~~~~~a~~~~~~~~~~~~~~~~~p~~~~~eVlVkv~~~~i~~~D~~~~~g~~~~~~~p~~~G~e~vG~Vv~vG~~v   82 (239)
                      +...++++||+++++.+++++++|++.|+|++||||||++++|||++|++.+.+......+|.++|||++|+|+++|+++
T Consensus         2 ~~~~~~~~kAav~~~~~~pl~i~ev~~P~p~~~eVlIkv~a~giCgsD~~~~~g~~~~~~~p~i~GhE~~G~v~~vG~~v   81 (199)
T d1cdoa1           2 TVGKVIKCKAAVAWEANKPLVIEEIEVDVPHANEIRIKIIATGVCHTDLYHLFEGKHKDGFPVVLGHEGAGIVESVGPGV   81 (199)
T ss_dssp             CTTSCEEEEEEEBCSTTSCCEEEEEEECCCCTTEEEEEEEEEECCHHHHHHHHTTCCTTSCSEECCCCEEEEEEEECTTC
T ss_pred             CCCCceEEEEEEEecCCCCcEEEEEECCCCCCCEEEEEEEEEEEecchhhhhhhcccccccccccccccceEEEEEcCCC
Confidence            34678899999999999999999999999999999999999999999999999977767899999999999999999999


Q ss_pred             CCCCCCCEEeecCccCCCCCccccCCCCCCCCCcCCCCCCceeccCCccccccCCcceeeecCCcceeeeEEEecceeEe
Q 026414           83 TEVQPGDHVIPCYQAECRECKFCKSGKTNLCGKVRGATGAGVMMNDRKSRFSINGKPIYHFMGTSTFSQYTVVHDVSVAK  162 (239)
Q Consensus        83 ~~~~~Gd~V~~~~~~~~~~c~~c~~~~~~~c~~~~~~~~~G~~~~~g~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~  162 (239)
                      ++|++||||++.+...|++|.+|+.++.+.|.+.......+.. .++..+...+|...++....|+|+||++++++.+++
T Consensus        82 ~~~~~GdrV~~~~~~~cg~c~~C~~g~~~~C~~~~~~~~~~~~-~~~~~~~~~~g~~~~~~~~~Ggfaey~~v~~~~~~~  160 (199)
T d1cdoa1          82 TEFQPGEKVIPLFISQCGECRFCQSPKTNQCVKGWANESPDVM-SPKETRFTCKGRKVLQFLGTSTFSQYTVVNQIAVAK  160 (199)
T ss_dssp             CSCCTTCEEEECSSCCCSSSHHHHCTTCCCCSCSGGGTCTTTT-SCSCCCEEETTEEEEEGGGTCCSBSEEEEEGGGEEE
T ss_pred             ceecCCCEEEEeeeccccccccccCCCcccccccccccccccc-cCcccceeeccceeecccccCCceEEEEEchHHEEE
Confidence            9999999999999999999999999999999987655455554 777788888999999999999999999999999999


Q ss_pred             cCCCCCchhhhhcccccchhhhhhhhhcCCCCCCEEEEE
Q 026414          163 IDPQAPLDKVCLLGCGVPTGLGAVWNTAKVEPGSIVAVF  201 (239)
Q Consensus       163 ~p~~~~~~~aa~l~~~~~ta~~~~~~~~~~~~g~~vlI~  201 (239)
                      +|+++++++++++.+++.|+++++......+.|++|||+
T Consensus       161 iP~~~~~~~aa~l~~~l~t~~~av~~~~~~~~G~tVlv~  199 (199)
T d1cdoa1         161 IDPSVKLDEFITHRMPLESVNDAIDLMKHGKCIRTVLSL  199 (199)
T ss_dssp             CCTTSCCGGGEEEEEEGGGHHHHHHHHHTTCCSEEEEEC
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHhCCCCCCCEEEeC
Confidence            999999999999999999999999888889999999984



>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure