Citrus Sinensis ID: 026469

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MERTGGFRGYRQQLPNASRGPGLKFTETNIRLASAHEINQTNNNNHTNYEDNECTVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREMEGERGSIRGEPPLVKRPPVEFRTLGVAAFAAPAAAFHHMGLGRGHGFLGAATAAAATGTYFNNNDPSNNNTAAGSSQPAVANGETYAHNK
ccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHcccccccccccHHcccccccccccccccccHHHHcccccccccccccccccccccccccccccccccc
*****************************************************CTVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREM***************************************GLGRGHGFLGAATAAAAT*********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERTGGFRGYRQQLPNASRGPGLKFTETNIRLASAHEINQTNNNNHTNYEDNECTVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREMEGERGSIRGEPPLVKRPPVEFRTLGVAAFAAPAAAFHHMGLGRGHGFLGAATAAAATGTYFNNNDPSNNNTAAGSSQPAVANGETYAHNK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nuclear transcription factor Y subunit B-6 Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway.probableQ84W66

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BYK, chain B
Confidence level:very confident
Coverage over the Query: 64-146
View the alignment between query and template
View the model in PyMOL