Citrus Sinensis ID: 026469

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MERTGGFRGYRQQLPNASRGPGLKFTETNIRLASAHEINQTNNNNHTNYEDNECTVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREMEGERGSIRGEPPLVKRPPVEFRTLGVAAFAAPAAAFHHMGLGRGHGFLGAATAAAATGTYFNNNDPSNNNTAAGSSQPAVANGETYAHNK
ccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHccccccccccHHcccccccccccccccccHHHHcccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHHHHccccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEcHHHHHHHHHHcccHHHHHHHHHHHHHHHcHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mertggfrgyrqqlpnasrgpglkfteTNIRLASAHEInqtnnnnhtnyednectvreqdrfmpIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKlgfddyiepLTVYLHRYRemegergsirgepplvkrppvefrtlgvaafaaPAAAFhhmglgrghgflGAATAAAAtgtyfnnndpsnnntaagssqpavangetyahnk
mertggfrgyrqqlpnasrgpglKFTETNIRLASAHeinqtnnnnhtnyEDNECTVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREMEgergsirgepplvkRPPVEFRTLGVAAFAAPAAAFHHMGLGRGHGFLGAATAAAATGTYFNNNDPSNNNtaagssqpavangetyahnk
MERTGGFRGYRQQLPNASRGPGLKFTETNIRLASAHEInqtnnnnhtnYEDNECTVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREMEGERGSIRGEPPLVKRPPVEFRTLGVaafaapaaafHHMGLGRGHGFLgaataaaatgtYFnnndpsnnnTAAGSSQPAVANGETYAHNK
****************************************************ECTVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREM****************PPVEFRTLGVAAFAAPAAAFHHMGLGRGHGFLGAATAAAATGTYF*****************************
************************************************************RFMPIANVIRIMRKILPQ**KISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYL************************************************************************************************
MERTGGFRGYRQQLPNASRGPGLKFTETNIRLASAHEINQTNNNNHTNYEDNECTVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREMEGERGSIRGEPPLVKRPPVEFRTLGVAAFAAPAAAFHHMGLGRGHGFLGAATAAAATGTYFNNNDPSNNNTAAGSSQPAVANGETYAHNK
*****************************************************CTVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREME**************************************GLGRGHGFLGAATAAAAT*************T*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERTGGFRGYRQQLPNASRGPGLKFTETNIRLASAHEINQTNNNNHTNYEDNECTVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREMEGERGSIRGEPPLVKRPPVEFRTLGVAAFAAPAAAFHHMGLGRGHGFLGAATAAAATGTYFNNNDPSNNNTAAGSSQPAVANGETYAHNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query238 2.2.26 [Sep-21-2011]
Q84W66234 Nuclear transcription fac yes no 0.617 0.628 0.716 5e-57
Q9SFD8238 Nuclear transcription fac no no 0.512 0.512 0.739 1e-50
O23310161 Nuclear transcription fac no no 0.491 0.726 0.615 1e-40
Q9FGJ3190 Nuclear transcription fac no no 0.428 0.536 0.689 7e-39
Q8VYK4173 Nuclear transcription fac no no 0.457 0.630 0.636 1e-38
P25209179 Nuclear transcription fac N/A no 0.403 0.536 0.697 1e-38
Q67XJ2176 Nuclear transcription fac no no 0.457 0.619 0.645 2e-38
Q60EQ4185 Nuclear transcription fac no no 0.403 0.518 0.697 3e-38
Q9SLG0141 Nuclear transcription fac no no 0.407 0.687 0.639 4e-37
Q9SIT9215 Nuclear transcription fac no no 0.403 0.446 0.656 2e-36
>sp|Q84W66|NFYB6_ARATH Nuclear transcription factor Y subunit B-6 OS=Arabidopsis thaliana GN=NFYB6 PE=1 SV=2 Back     alignment and function desciption
 Score =  221 bits (562), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 114/159 (71%), Positives = 127/159 (79%), Gaps = 12/159 (7%)

Query: 1   MERTGGFRGYRQQLPNAS--RGPGLK----FTETNIRLASAHEINQTNNNNHTNYEDNEC 54
           MER GGF GYR+   N +    PGL       E ++R    ++ N+T+N       + EC
Sbjct: 1   MER-GGFHGYRKLSVNNTTPSPPGLAANFLMAEGSMRPPEFNQPNKTSNGG-----EEEC 54

Query: 55  TVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQR 114
           TVREQDRFMPIANVIRIMR+ILP HAKISDD+KETIQECVSEYISFITGEANERCQREQR
Sbjct: 55  TVREQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQR 114

Query: 115 KTITAEDVLWAMSKLGFDDYIEPLTVYLHRYREMEGERG 153
           KTITAEDVLWAMSKLGFDDYIEPLT+YLHRYRE+EGERG
Sbjct: 115 KTITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEGERG 153
Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9SFD8|NFYB9_ARATH Nuclear transcription factor Y subunit B-9 OS=Arabidopsis thaliana GN=NFYB9 PE=1 SV=2 Back     alignment and function description
>sp|O23310|NFYB3_ARATH Nuclear transcription factor Y subunit B-3 OS=Arabidopsis thaliana GN=NFYB3 PE=2 SV=1 Back     alignment and function description
>sp|Q9FGJ3|NFYB2_ARATH Nuclear transcription factor Y subunit B-2 OS=Arabidopsis thaliana GN=NFYB2 PE=2 SV=1 Back     alignment and function description
>sp|Q8VYK4|NFYB8_ARATH Nuclear transcription factor Y subunit B-8 OS=Arabidopsis thaliana GN=NFYB8 PE=2 SV=1 Back     alignment and function description
>sp|P25209|NFYB_MAIZE Nuclear transcription factor Y subunit B OS=Zea mays GN=NFY2 PE=2 SV=1 Back     alignment and function description
>sp|Q67XJ2|NFYBA_ARATH Nuclear transcription factor Y subunit B-10 OS=Arabidopsis thaliana GN=NFYB10 PE=2 SV=1 Back     alignment and function description
>sp|Q60EQ4|NFYB3_ORYSJ Nuclear transcription factor Y subunit B-3 OS=Oryza sativa subsp. japonica GN=NFYB3 PE=1 SV=2 Back     alignment and function description
>sp|Q9SLG0|NFYB1_ARATH Nuclear transcription factor Y subunit B-1 OS=Arabidopsis thaliana GN=NFYB1 PE=1 SV=2 Back     alignment and function description
>sp|Q9SIT9|NFYB7_ARATH Nuclear transcription factor Y subunit B-7 OS=Arabidopsis thaliana GN=NFYB7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
126363024213 leafy cotyledon1-like protein [Theobroma 0.894 1.0 0.693 5e-73
359497402211 PREDICTED: nuclear transcription factor 0.878 0.990 0.659 7e-70
294438966222 leafy cotyledon1-like protein [Dimocarpu 0.890 0.954 0.670 4e-69
255629434225 unknown [Glycine max] 0.907 0.96 0.613 3e-68
158525287233 transcription factor LEC1-B [Glycine lat 0.852 0.871 0.65 1e-67
358248756226 nuclear transcription factor Y subunit B 0.831 0.876 0.651 2e-67
285020029225 leafy cotyledon 1-B [Arachis hypogaea] 0.705 0.746 0.768 9e-67
346230996226 leafy cotyledon 1 transcription factor [ 0.911 0.960 0.643 1e-66
351726744223 transcription factor LEC1-A [Glycine max 0.886 0.946 0.617 4e-66
255628047223 unknown [Glycine max] 0.886 0.946 0.613 4e-65
>gi|126363024|emb|CAM35799.1| leafy cotyledon1-like protein [Theobroma cacao] Back     alignment and taxonomy information
 Score =  279 bits (714), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 165/238 (69%), Positives = 177/238 (74%), Gaps = 25/238 (10%)

Query: 1   MERTGGFRGYRQQLPNASRGPGLKFTETNIRLASAHEINQTNNNNHTNYEDNECTVREQD 60
           MER GGF GYR+ LPN +   GLK  E N+R+A   E+N TNN  H+N +DNECTVREQD
Sbjct: 1   MER-GGFHGYRK-LPNNTTS-GLKVPEMNMRMA---EVNHTNN--HSNSDDNECTVREQD 52

Query: 61  RFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAE 120
           RFMPIANVIRIMRKILP HAKISDDAKETIQECVSEYISFITGEANERCQREQRKT TAE
Sbjct: 53  RFMPIANVIRIMRKILPPHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTTTAE 112

Query: 121 DVLWAMSKLGFDDYIEPLTVYLHRYREMEGERGSIRGEPPLVKRPPVEFRTLGVAAFAAP 180
           DVLWAMSKLGFDDYIEPLTVYLHRYRE+EGERGSIRGE PL KR  V++  L VAAF AP
Sbjct: 113 DVLWAMSKLGFDDYIEPLTVYLHRYRELEGERGSIRGE-PLGKR-AVDYGALSVAAF-AP 169

Query: 181 AAAFHHMGLGRGHGFLGAATAAAATGTYFNNNDPSNNNTAAGSSQPAVANGETYAHNK 238
           A    H          G      A G Y    D SN    AGSSQ AVANGE + H+K
Sbjct: 170 AFHMGHH--------HGFFGGGGAMGGYL--KDASN----AGSSQAAVANGEPFGHHK 213

Source: Theobroma cacao

Species: Theobroma cacao

Genus: Theobroma

Family: Malvaceae

Order: Malvales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359497402|ref|XP_003635503.1| PREDICTED: nuclear transcription factor Y subunit B-6-like [Vitis vinifera] gi|296083539|emb|CBI23532.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|294438966|gb|ADD82425.2| leafy cotyledon1-like protein [Dimocarpus longan] gi|301323235|gb|ADK70389.1| leafy cotyledon1-like protein [Dimocarpus longan] Back     alignment and taxonomy information
>gi|255629434|gb|ACU15063.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|158525287|gb|ABW71517.1| transcription factor LEC1-B [Glycine latifolia] Back     alignment and taxonomy information
>gi|358248756|ref|NP_001239679.1| nuclear transcription factor Y subunit B-6-like [Glycine max] gi|158525283|gb|ABW71515.1| transcription factor LEC1-B [Glycine max] Back     alignment and taxonomy information
>gi|285020029|gb|ADC33213.1| leafy cotyledon 1-B [Arachis hypogaea] Back     alignment and taxonomy information
>gi|346230996|gb|AEO22132.1| leafy cotyledon 1 transcription factor [Jatropha curcas] Back     alignment and taxonomy information
>gi|351726744|ref|NP_001236625.1| transcription factor LEC1-A [Glycine max] gi|158525281|gb|ABW71514.1| transcription factor LEC1-A [Glycine max] Back     alignment and taxonomy information
>gi|255628047|gb|ACU14368.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
TAIR|locus:2169028234 NF-YB6 ""nuclear factor Y, sub 0.626 0.636 0.713 8.3e-51
TAIR|locus:2201163238 LEC1 "LEAFY COTYLEDON 1" [Arab 0.466 0.466 0.794 1.8e-46
TAIR|locus:2129885161 NF-YB3 ""nuclear factor Y, sub 0.453 0.670 0.657 1.3e-36
TAIR|locus:2168983190 NF-YB2 ""nuclear factor Y, sub 0.428 0.536 0.689 4.4e-36
TAIR|locus:2061789173 NF-YB8 ""nuclear factor Y, sub 0.457 0.630 0.636 2.4e-35
TAIR|locus:2083941176 NF-YB10 ""nuclear factor Y, su 0.457 0.619 0.645 6.5e-35
TAIR|locus:2054095215 NF-YB7 ""nuclear factor Y, sub 0.428 0.474 0.627 1.5e-33
TAIR|locus:2043293160 NF-YB5 ""nuclear factor Y, sub 0.457 0.681 0.568 2.9e-32
DICTYBASE|DDB_G0279419 490 nfyB "putative histone-like tr 0.470 0.228 0.562 6.9e-31
UNIPROTKB|E1C5G6152 NFYB "Nuclear transcription fa 0.407 0.638 0.642 8.8e-31
TAIR|locus:2169028 NF-YB6 ""nuclear factor Y, subunit B6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 528 (190.9 bits), Expect = 8.3e-51, P = 8.3e-51
 Identities = 112/157 (71%), Positives = 121/157 (77%)

Query:     1 MERTGGFRGYRQ-QLPNASRGP-GLKFTETNIRLA--SAHEIXXXXXXXXXXYEDNECTV 56
             MER GGF GYR+  + N +  P GL     N  +A  S                + ECTV
Sbjct:     1 MER-GGFHGYRKLSVNNTTPSPPGLA---ANFLMAEGSMRPPEFNQPNKTSNGGEEECTV 56

Query:    57 REQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKT 116
             REQDRFMPIANVIRIMR+ILP HAKISDD+KETIQECVSEYISFITGEANERCQREQRKT
Sbjct:    57 REQDRFMPIANVIRIMRRILPAHAKISDDSKETIQECVSEYISFITGEANERCQREQRKT 116

Query:   117 ITAEDVLWAMSKLGFDDYIEPLTVYLHRYREMEGERG 153
             ITAEDVLWAMSKLGFDDYIEPLT+YLHRYRE+EGERG
Sbjct:   117 ITAEDVLWAMSKLGFDDYIEPLTLYLHRYRELEGERG 153
GO:0003677 "DNA binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;TAS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
GO:0009738 "abscisic acid mediated signaling pathway" evidence=IMP
GO:0033613 "activating transcription factor binding" evidence=IPI
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
TAIR|locus:2201163 LEC1 "LEAFY COTYLEDON 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129885 NF-YB3 ""nuclear factor Y, subunit B3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168983 NF-YB2 ""nuclear factor Y, subunit B2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061789 NF-YB8 ""nuclear factor Y, subunit B8"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083941 NF-YB10 ""nuclear factor Y, subunit B10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054095 NF-YB7 ""nuclear factor Y, subunit B7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043293 NF-YB5 ""nuclear factor Y, subunit B5"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279419 nfyB "putative histone-like transcription factor" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5G6 NFYB "Nuclear transcription factor Y subunit beta" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q84W66NFYB6_ARATHNo assigned EC number0.71690.61760.6282yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00010958001
SubName- Full=Chromosome undetermined scaffold_296, whole genome shotgun sequence; (211 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
pfam0080865 pfam00808, CBFD_NFYB_HMF, Histone-like transcripti 4e-26
COG203691 COG2036, HHT1, Histones H3 and H4 [Chromatin struc 2e-20
COG5150148 COG5150, COG5150, Class 2 transcription repressor 5e-15
pfam0012575 pfam00125, Histone, Core histone H2A/H2B/H3/H4 0.002
>gnl|CDD|201453 pfam00808, CBFD_NFYB_HMF, Histone-like transcription factor (CBF/NF-Y) and archaeal histone Back     alignment and domain information 
 Score = 96.1 bits (240), Expect = 4e-26
 Identities = 34/66 (51%), Positives = 43/66 (65%), Gaps = 1/66 (1%)

Query: 61  RFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAE 120
             +PIA V RIM+   P   +IS DAKE I ECV E+I FI  EA E C++E+RKTI AE
Sbjct: 1   AELPIARVKRIMKSD-PDAGRISQDAKELIAECVEEFIEFIASEAAEICKKEKRKTINAE 59

Query: 121 DVLWAM 126
            +  A+
Sbjct: 60  HIKLAV 65

This family includes archaebacterial histones and histone like transcription factors from eukaryotes. Length = 65
>gnl|CDD|224947 COG2036, HHT1, Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|227479 COG5150, COG5150, Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] Back     alignment and domain information
>gnl|CDD|201020 pfam00125, Histone, Core histone H2A/H2B/H3/H4 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 238
KOG0869168 consensus CCAAT-binding factor, subunit A (HAP3) [ 100.0
KOG0871156 consensus Class 2 transcription repressor NC2, bet 99.93
KOG0870172 consensus DNA polymerase epsilon, subunit D [Trans 99.9
COG5150148 Class 2 transcription repressor NC2, beta subunit 99.84
PF0080865 CBFD_NFYB_HMF: Histone-like transcription factor ( 99.73
COG203691 HHT1 Histones H3 and H4 [Chromatin structure and d 99.71
cd0007685 H4 Histone H4, one of the four histones, along wit 99.37
PLN00035103 histone H4; Provisional 99.33
PTZ00015102 histone H4; Provisional 99.29
smart0041774 H4 Histone H4. 99.15
smart0080365 TAF TATA box binding protein associated factor. TA 99.15
smart00428105 H3 Histone H3. 98.96
cd0798172 TAF12 TATA Binding Protein (TBP) Associated Factor 98.92
PF0012575 Histone: Core histone H2A/H2B/H3/H4 histone h2a si 98.9
COG5208286 HAP5 CCAAT-binding factor, subunit C [Transcriptio 98.67
PLN00161135 histone H3; Provisional 98.59
PLN00121136 histone H3; Provisional 98.58
PLN0016097 histone H3; Provisional 98.58
PTZ00018136 histone H3; Provisional 98.53
smart0057677 BTP Bromodomain transcription factors and PHD doma 98.47
KOG3467103 consensus Histone H4 [Chromatin structure and dyna 98.37
cd00074115 H2A Histone 2A; H2A is a subunit of the nucleosome 98.37
KOG1657236 consensus CCAAT-binding factor, subunit C (HAP5) [ 98.33
cd07979117 TAF9 TATA Binding Protein (TBP) Associated Factor 98.28
cd08050 343 TAF6 TATA Binding Protein (TBP) Associated Factor 98.08
KOG1745137 consensus Histones H3 and H4 [Chromatin structure 97.91
PF15511414 CENP-T: Centromere kinetochore component CENP-T; P 97.88
PF1563076 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 97.83
PF0752477 Bromo_TP: Bromodomain associated; InterPro: IPR006 97.71
PF0384768 TFIID_20kDa: Transcription initiation factor TFIID 97.66
smart0042789 H2B Histone H2B. 97.56
cd0804885 TAF11 TATA Binding Protein (TBP) Associated Factor 97.54
PF0296966 TAF: TATA box binding protein associated factor (T 97.49
KOG1659224 consensus Class 2 transcription repressor NC2, alp 97.42
PF0941572 CENP-X: CENP-S associating Centromere protein X; I 97.36
PLN00158116 histone H2B; Provisional 97.28
PTZ00463117 histone H2B; Provisional 97.24
PF0471990 TAFII28: hTAFII28-like protein conserved region; I 97.04
COG5262132 HTA1 Histone H2A [Chromatin structure and dynamics 97.0
smart00414106 H2A Histone 2A. 96.97
COG5247113 BUR6 Class 2 transcription repressor NC2, alpha su 96.87
KOG1142258 consensus Transcription initiation factor TFIID, s 96.75
PLN00154136 histone H2A; Provisional 96.66
PTZ00017134 histone H2A; Provisional 96.49
KOG1744127 consensus Histone H2B [Chromatin structure and dyn 96.25
PF15510102 CENP-W: Centromere kinetochore component W 96.19
PF02291129 TFIID-31kDa: Transcription initiation factor IID, 96.17
PF0226993 TFIID-18kDa: Transcription initiation factor IID, 96.12
PLN00157132 histone H2A; Provisional 96.11
PLN00153129 histone H2A; Provisional 96.05
KOG1756131 consensus Histone 2A [Chromatin structure and dyna 96.04
PLN00156139 histone H2AX; Provisional 96.02
KOG1658162 consensus DNA polymerase epsilon, subunit C [Repli 95.84
cd0797892 TAF13 The TATA Binding Protein (TBP) Associated Fa 95.62
KOG3219195 consensus Transcription initiation factor TFIID, s 95.29
PTZ00252134 histone H2A; Provisional 94.4
KOG4336 323 consensus TBP-associated transcription factor Prod 93.52
KOG2549 576 consensus Transcription initiation factor TFIID, s 92.92
KOG3423176 consensus Transcription initiation factor TFIID, s 92.67
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 91.31
PRK00411394 cdc6 cell division control protein 6; Reviewed 86.63
KOG3334148 consensus Transcription initiation factor TFIID, s 86.21
TIGR02928365 orc1/cdc6 family replication initiation protein. M 83.39
KOG2389 353 consensus Predicted bromodomain transcription fact 82.76
>KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] Back     alignment and domain information 
Probab=100.00  E-value=7.7e-37  Score=258.52  Aligned_cols=106  Identities=67%  Similarity=1.153  Sum_probs=101.3

Q ss_pred             CCcccccccccCCchhHHHHHHHhhCCCCcccCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCccCcccHHHHHhhcC
Q 026469           51 DNECTVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLG  130 (238)
Q Consensus        51 ~~e~~v~e~D~~LPkA~I~RImKeaLp~~~rISkDAkeaLqecaseFI~~LaseAne~A~~~kRKTItaEDVL~ALe~LG  130 (238)
                      ...+.++++|++||+|+|.||||+.||.+.+||||||+.+|+|++|||+|||++|+++|++++||||++|||||||..||
T Consensus        21 ~~~~~~reqDr~LPIANV~RIMK~~lP~naKIsKDAKE~vQECVSEfISFvT~EAsekC~~EkRKTIngdDllwAm~tLG  100 (168)
T KOG0869|consen   21 QSSLSLREQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASEKCQREKRKTINGDDLLWAMSTLG  100 (168)
T ss_pred             ccccccchhhhhccHHHHHHHHHhcCCcccccchHHHHHHHHHHHHHHHHHhhHHHHHHHHHhcCcccHHHHHHHHHHcC
Confidence            34688999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCcchHHHHHHHHHHHHHHhhhcCCC
Q 026469          131 FDDYIEPLTVYLHRYREMEGERGSIR  156 (238)
Q Consensus       131 F~dyve~Lk~~L~~yRE~~~~rks~k  156 (238)
                      |++|+++|+.||.+|||.+.+|+...
T Consensus       101 Fe~Y~eplkiyL~kYRe~e~e~~~~~  126 (168)
T KOG0869|consen  101 FENYAEPLKIYLQKYRELEGERGRSG  126 (168)
T ss_pred             cHhHHHHHHHHHHHHHHHhhhccccc
Confidence            99999999999999999988876543

>KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] Back     alignment and domain information
>KOG0870 consensus DNA polymerase epsilon, subunit D [Transcription] Back     alignment and domain information
>COG5150 Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] Back     alignment and domain information
>PF00808 CBFD_NFYB_HMF: Histone-like transcription factor (CBF/NF-Y) and archaeal histone; InterPro: IPR003958 The CCAAT-binding factor (CBF) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin Back     alignment and domain information
>COG2036 HHT1 Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>cd00076 H4 Histone H4, one of the four histones, along with H2A, H2B and H3, which forms the eukaryotic nucleosome core; along with H3, it plays a central role in nucleosome formation; histones bind to DNA and wrap the genetic material into "beads on a string" in which DNA (the string) is wrapped around small blobs of histones (the beads) at regular intervals; play a role in the inheritance of specialized chromosome structures and the control of gene activity; defects in the establishment of proper chromosome structure by histones may activate or silence genes aberrantly and thus lead to disease; the sequence of histone H4 has remained almost invariant in more than 2 billion years of evolution Back     alignment and domain information
>PLN00035 histone H4; Provisional Back     alignment and domain information
>PTZ00015 histone H4; Provisional Back     alignment and domain information
>smart00417 H4 Histone H4 Back     alignment and domain information
>smart00803 TAF TATA box binding protein associated factor Back     alignment and domain information
>smart00428 H3 Histone H3 Back     alignment and domain information
>cd07981 TAF12 TATA Binding Protein (TBP) Associated Factor 12 (TAF12) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF00125 Histone: Core histone H2A/H2B/H3/H4 histone h2a signature histone h2b signature histone h3 signature histone h4 signature; InterPro: IPR007125 The core histones together with some other DNA binding proteins appear to form a superfamily defined by a common fold and distant sequence similarities [, ] Back     alignment and domain information
>COG5208 HAP5 CCAAT-binding factor, subunit C [Transcription] Back     alignment and domain information
>PLN00161 histone H3; Provisional Back     alignment and domain information
>PLN00121 histone H3; Provisional Back     alignment and domain information
>PLN00160 histone H3; Provisional Back     alignment and domain information
>PTZ00018 histone H3; Provisional Back     alignment and domain information
>smart00576 BTP Bromodomain transcription factors and PHD domain containing proteins Back     alignment and domain information
>KOG3467 consensus Histone H4 [Chromatin structure and dynamics] Back     alignment and domain information
>cd00074 H2A Histone 2A; H2A is a subunit of the nucleosome Back     alignment and domain information
>KOG1657 consensus CCAAT-binding factor, subunit C (HAP5) [Transcription] Back     alignment and domain information
>cd07979 TAF9 TATA Binding Protein (TBP) Associated Factor 9 (TAF9) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG1745 consensus Histones H3 and H4 [Chromatin structure and dynamics] Back     alignment and domain information
>PF15511 CENP-T: Centromere kinetochore component CENP-T; PDB: 3B0D_T 3B0C_T 3VH5_T 3VH6_T Back     alignment and domain information
>PF15630 CENP-S: Kinetochore component CENP-S; PDB: 4DRA_C 4DRB_H 3V9R_C Back     alignment and domain information
>PF07524 Bromo_TP: Bromodomain associated; InterPro: IPR006565 This bromodomain is found in eukaryotic transcription factors and PHD domain containing proteins (IPR001965 from INTERPRO) Back     alignment and domain information
>PF03847 TFIID_20kDa: Transcription initiation factor TFIID subunit A; InterPro: IPR003228 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>smart00427 H2B Histone H2B Back     alignment and domain information
>cd08048 TAF11 TATA Binding Protein (TBP) Associated Factor 11 (TAF11) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF02969 TAF: TATA box binding protein associated factor (TAF); InterPro: IPR004823 The TATA box binding protein associated factor (TAF) is part of the transcription initiation factor TFIID multimeric protein complex Back     alignment and domain information
>KOG1659 consensus Class 2 transcription repressor NC2, alpha subunit (DRAP1) [Transcription] Back     alignment and domain information
>PF09415 CENP-X: CENP-S associating Centromere protein X; InterPro: IPR018552 Centromere protein X (CENP-X) is a component of the CENP-S complex Back     alignment and domain information
>PLN00158 histone H2B; Provisional Back     alignment and domain information
>PTZ00463 histone H2B; Provisional Back     alignment and domain information
>PF04719 TAFII28: hTAFII28-like protein conserved region; InterPro: IPR006809 The general transcription factor, TFIID, consists of the TATA-binding protein (TBP) associated with a series of TBP-associated factors (TAFs) that together participate in the assembly of the transcription preinitiation complex Back     alignment and domain information
>COG5262 HTA1 Histone H2A [Chromatin structure and dynamics] Back     alignment and domain information
>smart00414 H2A Histone 2A Back     alignment and domain information
>COG5247 BUR6 Class 2 transcription repressor NC2, alpha subunit (DRAP1 homolog) [Transcription] Back     alignment and domain information
>KOG1142 consensus Transcription initiation factor TFIID, subunit TAF12 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PLN00154 histone H2A; Provisional Back     alignment and domain information
>PTZ00017 histone H2A; Provisional Back     alignment and domain information
>KOG1744 consensus Histone H2B [Chromatin structure and dynamics] Back     alignment and domain information
>PF15510 CENP-W: Centromere kinetochore component W Back     alignment and domain information
>PF02291 TFIID-31kDa: Transcription initiation factor IID, 31kD subunit; InterPro: IPR003162 Human transcription initiation factor TFIID is composed of the TATA-binding polypeptide (TBP) and at least 13 TBP-associated factors (TAFs) that collectively or individually are involved in activator-dependent transcription [] Back     alignment and domain information
>PF02269 TFIID-18kDa: Transcription initiation factor IID, 18kD subunit; InterPro: IPR003195 This family includes the Spt3 yeast transcription factors and the 18 kDa subunit from human transcription initiation factor IID (TFIID-18) Back     alignment and domain information
>PLN00157 histone H2A; Provisional Back     alignment and domain information
>PLN00153 histone H2A; Provisional Back     alignment and domain information
>KOG1756 consensus Histone 2A [Chromatin structure and dynamics] Back     alignment and domain information
>PLN00156 histone H2AX; Provisional Back     alignment and domain information
>KOG1658 consensus DNA polymerase epsilon, subunit C [Replication, recombination and repair] Back     alignment and domain information
>cd07978 TAF13 The TATA Binding Protein (TBP) Associated Factor 13 (TAF13) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>KOG3219 consensus Transcription initiation factor TFIID, subunit TAF11 [Transcription] Back     alignment and domain information
>PTZ00252 histone H2A; Provisional Back     alignment and domain information
>KOG4336 consensus TBP-associated transcription factor Prodos [Transcription] Back     alignment and domain information
>KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG3423 consensus Transcription initiation factor TFIID, subunit TAF10 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>KOG3334 consensus Transcription initiation factor TFIID, subunit TAF9 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG2389 consensus Predicted bromodomain transcription factor [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
1n1j_A93 Crystal Structure Of The Nf-YbNF-Yc Histone Pair Le 2e-32
4awl_B94 The Nf-y Transcription Factor Is Structurally And F 2e-32
4g91_B92 Ccaat-Binding Complex From Aspergillus Nidulans Len 2e-31
1jfi_B179 Crystal Structure Of The Nc2-Tbp-Dna Ternary Comple 2e-11
2byk_B128 Histone Fold Heterodimer Of The Chromatin Accessibi 7e-08
>pdb|1N1J|A Chain A, Crystal Structure Of The Nf-YbNF-Yc Histone Pair Length = 93 Back     alignment and structure 
Iteration: 1

 Score =  135 bits (340), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 76/93 (81%)
Query: 55  TVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQR 114
           + REQD ++PIANV RIM+  +PQ  KI+ DAKE +QECVSE+ISFIT EA+ERC +E+R
Sbjct: 1   SFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKR 60
Query: 115 KTITAEDVLWAMSKLGFDDYIEPLTVYLHRYRE 147
           KTI  ED+L+AMS LGFD Y+EPL +YL ++RE
Sbjct: 61  KTINGEDILFAMSTLGFDSYVEPLKLYLQKFRE 93
>pdb|4AWL|B Chain B, The Nf-y Transcription Factor Is Structurally And Functionally A Sequence Specific Histone Length = 94 Back     alignment and structure
>pdb|4G91|B Chain B, Ccaat-Binding Complex From Aspergillus Nidulans Length = 92 Back     alignment and structure
>pdb|1JFI|B Chain B, Crystal Structure Of The Nc2-Tbp-Dna Ternary Complex Length = 179 Back     alignment and structure
>pdb|2BYK|B Chain B, Histone Fold Heterodimer Of The Chromatin Accessibility Complex Length = 128 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 4e-46
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 4e-45
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 5e-42
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 6e-26
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 3e-23
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 2e-11
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 2e-10
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 2e-08
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 5e-04
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 93 Back     alignment and structure
 Score =  147 bits (373), Expect = 4e-46
 Identities = 59/93 (63%), Positives = 76/93 (81%)

Query: 55  TVREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQR 114
           + REQD ++PIANV RIM+  +PQ  KI+ DAKE +QECVSE+ISFIT EA+ERC +E+R
Sbjct: 1   SFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKR 60

Query: 115 KTITAEDVLWAMSKLGFDDYIEPLTVYLHRYRE 147
           KTI  ED+L+AMS LGFD Y+EPL +YL ++RE
Sbjct: 61  KTINGEDILFAMSTLGFDSYVEPLKLYLQKFRE 93
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Length = 128 Back     alignment and structure
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Length = 179 Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Length = 68 Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Length = 70 Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Length = 97 Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Length = 140 Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Length = 111 Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Length = 84 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
1jfi_B179 DR1 protein, transcription regulator NC2 beta chai 99.96
2byk_B128 Chrac-14; nucleosome sliding, histone fold, DNA-bi 99.96
1n1j_A93 NF-YB; histone-like PAIR, DNA binding protein; 1.6 99.96
3b0c_W76 CENP-W, centromere protein W; histone fold, DNA bi 99.85
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.82
3b0c_T111 CENP-T, centromere protein T; histone fold, DNA bi 99.79
1b67_A68 Protein (histone HMFA); DNA binding protein; 1.48A 99.78
1f1e_A154 Histone fold protein; archaeal histone protein, DN 99.71
2hue_C84 Histone H4; mini beta sheet, elongated beta sandwh 99.7
1id3_B102 Histone H4; nucleosome core particle, chromatin, p 99.69
2byk_A140 Chrac-16; nucleosome sliding, histone fold, DNA-bi 99.68
4g92_C119 HAPE; transcription factor, nucleosome, minor groo 99.63
1tzy_D103 Histone H4-VI; histone-fold, tetramer-dimer-dimer, 99.63
1n1j_B97 NF-YC; histone-like PAIR, DNA binding protein; 1.6 99.61
2yfw_B103 Histone H4, H4; cell cycle, kinetochore, centromer 99.61
1ku5_A70 HPHA, archaeal histon; histone fold, DNA binding p 99.6
1jfi_A98 Transcription regulator NC2 alpha chain; histone, 99.33
2hue_B77 Histone H3; mini beta sheet, elongated beta sandwh 99.16
2yfv_A100 Histone H3-like centromeric protein CSE4; cell cyc 99.08
3nqj_A82 Histone H3-like centromeric protein A; alpha helix 99.03
3r45_A156 Histone H3-like centromeric protein A; histone fol 99.01
3nqu_A140 Histone H3-like centromeric protein A; alpha helix 99.0
1tzy_C136 Histone H3; histone-fold, tetramer-dimer-dimer, DN 98.99
1taf_B70 TFIID TBP associated factor 62; transcription init 98.92
4dra_A113 Centromere protein S; DNA binding complex, DNA dam 98.82
3vh5_A140 CENP-S; histone fold, chromosome segregation, DNA 98.79
3b0b_B107 CENP-S, centromere protein S; histone fold, DNA bi 98.75
3v9r_A90 MHF1, uncharacterized protein YOL086W-A; histone f 98.72
1taf_A68 TFIID TBP associated factor 42; transcription init 98.65
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 98.61
2nqb_C123 Histone H2A; nucleosome, NCP, chromatin, structura 98.48
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 98.46
1f66_C128 Histone H2A.Z; nucleosome, chromatin, histone vari 98.45
1tzy_A129 Histone H2A-IV; histone-fold, tetramer-dimer-dimer 98.44
2f8n_G120 Core histone macro-H2A.1; nucleosome, NCP, macroh2 98.43
1id3_C131 Histone H2A.1; nucleosome core particle, chromatin 98.42
2f8n_K149 Histone H2A type 1; nucleosome, NCP, macroh2A, his 98.37
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 98.22
2nqb_D123 Histone H2B; nucleosome, NCP, chromatin, structura 98.18
1tzy_B126 Histone H2B; histone-fold, tetramer-dimer-dimer, D 98.13
2l5a_A235 Histone H3-like centromeric protein CSE4, protein 98.1
2jss_A192 Chimera of histone H2B.1 and histone H2A.Z; histon 97.85
4dra_E84 Centromere protein X; DNA binding complex, DNA dam 97.82
1h3o_B76 Transcription initiation factor TFIID 20/15 kDa su 97.75
3b0b_C81 CENP-X, centromere protein X; histone fold, DNA bi 97.69
1bh9_B89 TAFII28; histone fold, tata binding protein, trans 97.45
3v9r_B88 MHF2, uncharacterized protein YDL160C-A; histone f 96.01
2ly8_A121 Budding yeast chaperone SCM3; centromere protein, 95.98
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 90.85
3ksy_A 1049 SOS-1, SON of sevenless homolog 1; RAS, RAS activa 86.51
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 84.66
2v1u_A387 Cell division control protein 6 homolog; DNA repli 83.3
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 82.19
>1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
Probab=99.96  E-value=3.8e-29  Score=214.10  Aligned_cols=97  Identities=31%  Similarity=0.637  Sum_probs=91.5

Q ss_pred             ccccccCCchhHHHHHHHhhCCCCcccCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCccCcccHHHHHhhcCCCcch
Q 026469           56 VREQDRFMPIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYI  135 (238)
Q Consensus        56 v~e~D~~LPkA~I~RImKeaLp~~~rISkDAkeaLqecaseFI~~LaseAne~A~~~kRKTItaEDVL~ALe~LGF~dyv  135 (238)
                      -.++|+.||+|+|.||||++|| +++||+||+++|++||++||+||+++|+++|.+++||||+++||++||++|||++|+
T Consensus         9 ~~~eD~~LP~A~V~RImK~alp-~~rISkDA~~al~ec~~eFI~~LtseA~e~a~~~~RKTI~~eDVl~Al~~LgF~~fv   87 (179)
T 1jfi_B            9 GNDDDLTIPRAAINKMIKETLP-NVRVANDARELVVNCCTEFIHLISSEANEICNKSEKKTISPEHVIQALESLGFGSYI   87 (179)
T ss_dssp             ---CCCCCCHHHHHHHHHHHST-TCCBCHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSSBCHHHHHHHHHHHTTGGGH
T ss_pred             CchhhhhcCHHHHHHHHHHhCC-ccccCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCcCCHHHHHHHHHhcChHHHH
Confidence            4678999999999999999999 999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHhhhc
Q 026469          136 EPLTVYLHRYREMEGERG  153 (238)
Q Consensus       136 e~Lk~~L~~yRE~~~~rk  153 (238)
                      ++|+.+|++||++++.|+
T Consensus        88 ~~lk~~L~~yre~~~~kk  105 (179)
T 1jfi_B           88 SEVKEVLQECKTVALKRR  105 (179)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhCc
Confidence            999999999999987654
>2byk_B Chrac-14; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_B Back     alignment and structure
>1n1j_A NF-YB; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3b0c_W CENP-W, centromere protein W; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_W* 3vh5_W 3vh6_W Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>3b0c_T CENP-T, centromere protein T; histone fold, DNA binding, DNA binding protein; HET: CIT; 2.20A {Gallus gallus} PDB: 3b0d_T* 3vh5_T 3vh6_T Back     alignment and structure
>1b67_A Protein (histone HMFA); DNA binding protein; 1.48A {Methanothermus fervidus} SCOP: a.22.1.2 PDB: 1hta_A 1a7w_A 1b6w_A 1bfm_A Back     alignment and structure
>1f1e_A Histone fold protein; archaeal histone protein, DNA binding protein; HET: MSE; 1.37A {Methanopyrus kandleri} SCOP: a.22.1.2 Back     alignment and structure
>2hue_C Histone H4; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} SCOP: a.22.1.1 PDB: 3nqj_B 1aoi_B 3kwq_B* 1hio_D 2yfv_B Back     alignment and structure
>1id3_B Histone H4; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2byk_A Chrac-16; nucleosome sliding, histone fold, DNA-binding protein; 2.4A {Drosophila melanogaster} SCOP: a.22.1.3 PDB: 2bym_A Back     alignment and structure
>4g92_C HAPE; transcription factor, nucleosome, minor groove binding, CCAA complex, histone fold motif, specific binding to the ccaat- nucleus; HET: DNA; 1.80A {Aspergillus nidulans} PDB: 4g91_C* Back     alignment and structure
>1tzy_D Histone H4-VI; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1f66_B 1eqz_D 1hq3_D 1u35_B 2aro_D 2cv5_B* 2f8n_B 3nqu_B 3r45_B 3azg_B 3a6n_B 3an2_B 3av1_B 3av2_B 3ayw_B 3aze_B 3azf_B 3afa_B 3azh_B 3azk_B ... Back     alignment and structure
>1n1j_B NF-YC; histone-like PAIR, DNA binding protein; 1.67A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2yfw_B Histone H4, H4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.60A {Kluyveromyces lactis nrrl y-1140} Back     alignment and structure
>1ku5_A HPHA, archaeal histon; histone fold, DNA binding protein; 2.30A {Pyrococcus horikoshii} SCOP: a.22.1.2 Back     alignment and structure
>1jfi_A Transcription regulator NC2 alpha chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>2hue_B Histone H3; mini beta sheet, elongated beta sandwhich, DNA binding prote; 1.70A {Xenopus laevis} Back     alignment and structure
>2yfv_A Histone H3-like centromeric protein CSE4; cell cycle, kinetochore, centromere, histone chaperone, BUDD; 2.32A {Kluyveromyces lactis nrrl y-1140} PDB: 2yfw_A Back     alignment and structure
>3nqj_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.10A {Homo sapiens} Back     alignment and structure
>3r45_A Histone H3-like centromeric protein A; histone fold, centromere, CENP-A, histone chaperone, hjurp; 2.60A {Homo sapiens} Back     alignment and structure
>3nqu_A Histone H3-like centromeric protein A; alpha helix, histone fold, centromere, DNA binding protein; 2.50A {Homo sapiens} PDB: 3an2_A Back     alignment and structure
>1tzy_C Histone H3; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_C 1hq3_C 2aro_C 2f8n_A 2hio_C 3av1_A 3lel_A 3afa_A 3azi_A 3azj_A 3azk_A 3azl_A 3azm_A 3azn_A 2cv5_A* 1u35_A* 2nqb_A 2io5_B 2pyo_A* 3c9k_C ... Back     alignment and structure
>1taf_B TFIID TBP associated factor 62; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>4dra_A Centromere protein S; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_A Back     alignment and structure
>3vh5_A CENP-S; histone fold, chromosome segregation, DNA binding, nucleus, binding protein; 2.40A {Gallus gallus} PDB: 3vh6_A Back     alignment and structure
>3b0b_B CENP-S, centromere protein S; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} Back     alignment and structure
>3v9r_A MHF1, uncharacterized protein YOL086W-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1taf_A TFIID TBP associated factor 42; transcription initiation, histone fold, complex (TWO transcr factors); 2.00A {Drosophila melanogaster} SCOP: a.22.1.3 Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2nqb_C Histone H2A; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_C* Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1f66_C Histone H2A.Z; nucleosome, chromatin, histone variant, protein DNA interaction, nucleoprotein, supercoiled DNA, complex (nucleosome core/DNA); 2.60A {Homo sapiens} SCOP: a.22.1.1 Back     alignment and structure
>1tzy_A Histone H2A-IV; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_A 1hq3_A 2aro_A 2hio_A 3c9k_A 3azg_C 3a6n_C 3an2_C 3av1_C 3av2_C 3ayw_C 3aze_C 3azf_C 3afa_C 3azh_C 3azi_C 3azj_C 3azk_C 3azl_C 3azm_C ... Back     alignment and structure
>2f8n_G Core histone macro-H2A.1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Homo sapiens} SCOP: a.22.1.1 PDB: 1u35_C Back     alignment and structure
>1id3_C Histone H2A.1; nucleosome core particle, chromatin, protein/DNA interaction, nucleoprotein, supercoiled DNA; 3.10A {Saccharomyces cerevisiae} SCOP: a.22.1.1 Back     alignment and structure
>2f8n_K Histone H2A type 1; nucleosome, NCP, macroh2A, histone variant, chromatin, X- RAY structure, crystallography, structural protein/DNA complex; 2.90A {Mus musculus} SCOP: a.22.1.1 Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>2nqb_D Histone H2B; nucleosome, NCP, chromatin, structural protein/DNA complex; 2.30A {Drosophila melanogaster} PDB: 2pyo_D* Back     alignment and structure
>1tzy_B Histone H2B; histone-fold, tetramer-dimer-dimer, DNA binding protein; 1.90A {Gallus gallus} SCOP: a.22.1.1 PDB: 1eqz_B 1hq3_B 2aro_B 2hio_B 3c9k_B 3azg_D 3a6n_D 3an2_D 3av1_D 3av2_D 3ayw_D 3aze_D 3azf_D 3afa_D 3azh_D 3azi_D 3azj_D 3azk_D 3azl_D 3azm_D ... Back     alignment and structure
>2l5a_A Histone H3-like centromeric protein CSE4, protein histone H4; A single chain of CSE4+SCM3+H4, fusion protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jss_A Chimera of histone H2B.1 and histone H2A.Z; histone/chaperone complex, intrinsically unfolded protein, chaperone/structural protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.22.1.1 a.22.1.1 Back     alignment and structure
>4dra_E Centromere protein X; DNA binding complex, DNA damage repair, histone-fold, DNA BI protein; 2.41A {Homo sapiens} PDB: 4drb_J Back     alignment and structure
>1h3o_B Transcription initiation factor TFIID 20/15 kDa subunits; transcription/TBP-associated factors, TBP-associated factors; 2.3A {Homo sapiens} SCOP: a.22.1.3 Back     alignment and structure
>3b0b_C CENP-X, centromere protein X; histone fold, DNA binding, DNA, nucleus, DNA binding protein; 2.15A {Gallus gallus} PDB: 3vh5_D 3vh6_D Back     alignment and structure
>1bh9_B TAFII28; histone fold, tata binding protein, transcription regulation complex; HET: PMB; 2.60A {Homo sapiens} SCOP: a.22.1.3 PDB: 1bh8_B* Back     alignment and structure
>3v9r_B MHF2, uncharacterized protein YDL160C-A; histone fold, fanconi anemia, DNA repair, DNA BI protein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ly8_A Budding yeast chaperone SCM3; centromere protein, CENH3 variants, partially unfolded; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 238
d2bykb189 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila 1e-38
d1jfib_135 a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain 2e-34
d1n1ja_87 a.22.1.3 (A:) Nuclear transcription factor Y subun 2e-34
d1htaa_68 a.22.1.2 (A:) Archaeal histone {Archaeon Methanoth 2e-20
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 1e-19
d1f1ea_151 a.22.1.2 (A:) Archaeal histone {Archaeon Methanopy 4e-14
d1ku5a_66 a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococc 4e-18
d1n1jb_78 a.22.1.3 (B:) Nuclear transcription factor Y subun 1e-15
d1jfia_66 a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chai 3e-15
d2huec182 a.22.1.1 (C:20-101) Histone H4 {African clawed fro 6e-12
d1q9ca_172 a.22.1.3 (A:) Histone domain of Son of sevenless p 0.002
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 0.004
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 89 Back     information, alignment and structure

class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: TBP-associated factors, TAFs
domain: Chrac-14
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score =  127 bits (320), Expect = 1e-38
 Identities = 27/89 (30%), Positives = 52/89 (58%)

Query: 64  PIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVL 123
           P A + R++++ LP+ A +S +A+  I    S +  F+T  +     ++  KTITA+D+L
Sbjct: 1   PNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDIL 60

Query: 124 WAMSKLGFDDYIEPLTVYLHRYREMEGER 152
             +++L F+ ++  LT  L  YR++  E+
Sbjct: 61  QTLTELDFESFVPSLTQDLEVYRKVVKEK 89
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Length = 68 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 151 Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Length = 66 Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 66 Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 82 Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
d2bykb189 Chrac-14 {Fruit fly (Drosophila melanogaster) [Tax 99.94
d1jfib_135 Negative cofactor 2, NC2, beta chain {Human (Homo 99.94
d1n1ja_87 Nuclear transcription factor Y subunit beta (Nf-Yb 99.94
d1htaa_68 Archaeal histone {Archaeon Methanothermus fervidus 99.77
d1ku5a_66 Archaeal histone {Archaeon (Pyrococcus horikoshii) 99.75
d1n1jb_78 Nuclear transcription factor Y subunit gamma (Nf-Y 99.72
d1jfia_66 Negative cofactor 2, NC2, alpha chain {Human (Homo 99.58
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 99.57
d1f1ea_151 Archaeal histone {Archaeon Methanopyrus kandleri [ 99.47
d2huec182 Histone H4 {African clawed frog (Xenopus laevis) [ 99.38
d1tzyc_95 Histone H3 {Chicken (Gallus gallus), erythrocytes 98.86
d2byka172 Chrac-16 {Fruit fly (Drosophila melanogaster) [Tax 98.55
d1q9ca_172 Histone domain of Son of sevenless protein {Human 98.37
d1tzyb_92 Histone H2B {Chicken (Gallus gallus), erythrocytes 97.78
d1h3ob_74 TAF(II)-20, (TAF(II)-15, hTAF12), histone fold dom 97.44
d1tafb_70 TAF(II)62 {Fruit fly (Drosophila melanogaster) [Ta 97.36
d1bh9b_89 TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} 97.28
d1f66c_103 Histone H2A {Human (Homo sapiens), variant H2A.Z [ 97.13
d1u35c1106 macro-H2A.1, histone domain {Human (Homo sapiens) 96.79
d1tzya_106 Histone H2A {Chicken (Gallus gallus), erythrocytes 96.4
d1tafa_68 TAF(II)42 {Fruit fly (Drosophila melanogaster) [Ta 95.9
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.45
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.05
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 85.61
>d2bykb1 a.22.1.3 (B:11-99) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: Histone-fold
superfamily: Histone-fold
family: TBP-associated factors, TAFs
domain: Chrac-14
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.94  E-value=2.4e-27  Score=178.93  Aligned_cols=89  Identities=30%  Similarity=0.565  Sum_probs=86.8

Q ss_pred             chhHHHHHHHhhCCCCcccCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCccCcccHHHHHhhcCCCcchHHHHHHHH
Q 026469           64 PIANVIRIMRKILPQHAKISDDAKETIQECVSEYISFITGEANERCQREQRKTITAEDVLWAMSKLGFDDYIEPLTVYLH  143 (238)
Q Consensus        64 PkA~I~RImKeaLp~~~rISkDAkeaLqecaseFI~~LaseAne~A~~~kRKTItaEDVL~ALe~LGF~dyve~Lk~~L~  143 (238)
                      |+|+|.||||+.+|++++||+||+.+|++|+++||+||+++|++.|..++||||+++||++||+++||++|+++|+.+|+
T Consensus         1 P~a~i~ri~K~~~p~~~~iskeA~~~i~~aae~FI~~lt~~A~~~a~~~~rKtI~~~dv~~Al~~~~f~~~~~~l~~~l~   80 (89)
T d2bykb1           1 PNAVIGRLIKEALPESASVSKEARAAIARAASVFAIFVTSSSTALAHKQNHKTITAKDILQTLTELDFESFVPSLTQDLE   80 (89)
T ss_dssp             CCSHHHHHHHHHSCTTCEECHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSSCCHHHHHHHHHHTTCTTTHHHHHHHHH
T ss_pred             CccHHHHHHHHhCcccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCccCHHHHHHHHHHCCcHHHHHHHHHHHH
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhh
Q 026469          144 RYREMEGER  152 (238)
Q Consensus       144 ~yRE~~~~r  152 (238)
                      .||+.++.|
T Consensus        81 ~~~e~~~~k   89 (89)
T d2bykb1          81 VYRKVVKEK   89 (89)
T ss_dssp             HHHHHHTTC
T ss_pred             HHHHHHccC
Confidence            999988654
>d1jfib_ a.22.1.3 (B:) Negative cofactor 2, NC2, beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n1ja_ a.22.1.3 (A:) Nuclear transcription factor Y subunit beta (Nf-Yb3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htaa_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanothermus fervidus, histone A [TaxId: 2180]} Back     information, alignment and structure
>d1ku5a_ a.22.1.2 (A:) Archaeal histone {Archaeon (Pyrococcus horikoshii) [TaxId: 53953]} Back     information, alignment and structure
>d1n1jb_ a.22.1.3 (B:) Nuclear transcription factor Y subunit gamma (Nf-Yc2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfia_ a.22.1.3 (A:) Negative cofactor 2, NC2, alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1f1ea_ a.22.1.2 (A:) Archaeal histone {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2huec1 a.22.1.1 (C:20-101) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1tzyc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q9ca_ a.22.1.3 (A:) Histone domain of Son of sevenless protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tzyb_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1h3ob_ a.22.1.3 (B:) TAF(II)-20, (TAF(II)-15, hTAF12), histone fold domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tafb_ a.22.1.3 (B:) TAF(II)62 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bh9b_ a.22.1.3 (B:) TAF(II)28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f66c_ a.22.1.1 (C:) Histone H2A {Human (Homo sapiens), variant H2A.Z [TaxId: 9606]} Back     information, alignment and structure
>d1u35c1 a.22.1.1 (C:814-919) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tzya_ a.22.1.1 (A:) Histone H2A {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]} Back     information, alignment and structure
>d1tafa_ a.22.1.3 (A:) TAF(II)42 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure