Citrus Sinensis ID: 026543


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MAAVSSKKPITHVIFDMDGLLLDTEKFYTEVQELILARYNKTFDWSLKAKMMGKKAIEAAQVFVEETGISDKLSAEDFLVQREETLQTLFPTSELMPGASHLIRHLHAKGIPMCVATGSLARHFELKTQKHRELFSLMHHVVRGDDPEVKQGKPSPDIFLAAAKRFEGGPIDSQEILVFEDAPSGVLAAKNAGMSVVMVPDPRLDSSYHSNADQLLSSLLGFNPKDWGLPPFEDALN
cccccccccccEEEEEccccccccHHHHHHHHHHHHHHccccccHHHHHHcccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHccccccccccEEEEcccccccccccccHHHHHHHHHccccccccccEEEEEcccHHHHHHHHcccEEEEEccccccccccccccEEcccccccccccccccccccccc
******K**ITHVIFDMDGLLLDTEKFYTEVQELILARYNKTFDWSLKAKMMGKKAIEAAQVFVEETGISDKLSAEDFLVQREETLQTLFPTSELMPGASHLIRHLHAKGIPMCVATGSLARHFELKTQKHRELFSLMHHVVRGDDPEVKQGKPSPDIFLAAAKRFEGGPIDSQEILVFEDAPSGVLAAKNAGMSVVMVPDPRLDSSYHSNADQLLSSLLGFNPKDWGLPPFED***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAVSSKKPITHVIFDMDGLLLDTEKFYTEVQELILARYNKTFDWSLKAKMMGKKAIEAAQVFVEETGISDKLSAEDFLVQREETLQTLFPTSELMPGASHLIRHLHAKGIPMCVATGSLARHFELKTQKHRELFSLMHHVVRGDDPEVKQGKPSPDIFLAAAKRFEGGPIDSQEILVFEDAPSGVLAAKNAGMSVVMVPDPRLDSSYHSNADQLLSSLLGFNPKDWGLPPFEDALN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pseudouridine-5'-monophosphatase Dephosphorylates pseudouridine 5'-phosphate, a potential intermediate in rRNA degradation. Pseudouridine is then excreted intact in urine.probableQ08623
Putative uncharacterized hydrolase C1020.07 probableO59760
Putative uncharacterized hydrolase YKL033W-A probableQ86ZR7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L5K, chain A
Confidence level:very confident
Coverage over the Query: 7-233
View the alignment between query and template
View the model in PyMOL