Citrus Sinensis ID: 026545

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MIGVGKIKQYSNVLDKPLSKGKQEVSLSAFAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGARVLELLCHRDKGNRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAGIVRGVLDSAGFPAVVTAHFVPVEGQQRPRTTILIKFAEEQKYPSIFLTSLPCLNPPQKLGTTEGSKAGLILAPKLSYLIRLNVSQQNDEAV
cccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccccEEEEEcccccEEEEEEcccccccccccHHHHHHHHHHHHcccccEEEEEEEccccccccccEEEEEEccccccccccccccccccccccccccccccccEEEEcccccEEEEEcccccccccc
************************VSLSAFAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGARVLELLCHRDKGNRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAGIVRGVLDSAGFPAVVTAHFVPVEGQQRPRTTILIKFAEEQKYPSIFLTSLPCLNPPQKLGTTEGSKAGLILAPKLSYLIRLN*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGVGKIKQYSNVLDKPLSKGKQEVSLSAFAFLFSELVQYNQTQVDNIAELERRLEDAGYAVGARVLELLCHRDKGNRRETRLLGILSFVHSTVWKVLFGKVADSLEKGTEHEDEYMISEKELLVNRFISIPKDMGTFNCGAFVAGIVRGVLDSAGFPAVVTAHFVPVEGQQRPRTTILIKFAEEQKYPSIFLTSLPCLNPPQKLGTTEGSKAGLILAPKLSYLIRLNVSQQNDEAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Trafficking protein particle complex subunit 5 May play a role in vesicular transport from endoplasmic reticulum to Golgi.probableQ54YG5
Transport protein particle subunit trs31 TRAPP plays a key role in the late stages of endoplasmic reticulum to Golgi traffic.probableQ9P7N9
Trafficking protein particle complex subunit 5 May play a role in vesicular transport from endoplasmic reticulum to Golgi.probableQ2NL13

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J3W, chain B
Confidence level:very confident
Coverage over the Query: 22-194
View the alignment between query and template
View the model in PyMOL