Citrus Sinensis ID: 026566


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MIQNLLGTSVTFKFEAYMVFNNLMIMDACQIDFILGSWVHSELPTGAALNITSLSAYLNSSTDAPNLLIELIQSSPSSLVLILDLSPRKDLVLHPDYLQTFYESTRLDEYRQMLEKVPEVRPYFSSSLYLRCVISPSAIMVRVDTETETGAGESTRLDYIITNHVHPVAKQVIGIWLNQCACGGRHVGESDKAYLEKRDGLIKNKTIEIDLGSSFPRLFGPQVASRVLGEIQKVFTA
cccccccccEEEccccccccccEEccccccHHHHHHHHHcccccccccccHHHHHHcccccccccHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHccccHHHHHHHHHHcccccccccccccEEccccccEEEEEEEcccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcEEccccccccccccHHHHHHHHHHHHHHHHc
***NLLGTSVTFKFEAYMVFNNLMIMDACQIDFILGSWVHSELPTGAALNITSLSAYLNSSTDAPNLLIELIQSSPSSLVLILDLSPRKDLVLHPDYLQTFYESTRLDEYRQMLEKVPEVRPYFSSSLYLRCVISPSAIMVRVDTETETGAGESTRLDYIITNHVHPVAKQVIGIWLNQCACGGRHVGESDKAYLEKRDGLIKNKTIEIDLGSSFPRLFGPQVASRVLGEIQKVFT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQNLLGTSVTFKFEAYMVFNNLMIMDACQIDFILGSWVHSELPTGAALNITSLSAYLNSSTDAPNLLIELIQSSPSSLVLILDLSPRKDLVLHPDYLQTFYESTRLDEYRQMLEKVPEVRPYFSSSLYLRCVISPSAIMVRVDTETETGAGESTRLDYIITNHVHPVAKQVIGIWLNQCACGGRHVGESDKAYLEKRDGLIKNKTIEIDLGSSFPRLFGPQVASRVLGEIQKVFTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Red chlorophyll catabolite reductase, chloroplastic Catalyzes the key reaction of chlorophyll catabolism, porphyrin macrocycle cleavage of pheophorbide a (pheide a) to a primary fluorescent catabolite (pFCC). Works in a two-step reaction with pheophorbide a oxygenase (PaO) by reducing the C20/C1 double bond of the intermediate, RCC.probableQ8LDU4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3AGC, chain A
Confidence level:very confident
Coverage over the Query: 23-237
View the alignment between query and template
View the model in PyMOL