Citrus Sinensis ID: 026577


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MEQEADSAYKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEIGVPSESLVSYSLLIRYQVVVPALLLCGYMCTST
cccccccccHHHHccccccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHccccccccccEEccEEECcccccccccEEEEEEcccccccHccccccHHHHHHccccccccccccccccccccEEEEEEccccEEEEEccccccccccCEEcccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccEEEEEEEEcccEEEEEEEEccc
*****DS*YKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAG************FINHKVSQEMFDSITREVVEEIGVPSESLVSYSLLIRYQVVVPALLLCGYMCTST
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQEADSAYKLLLSCPHGFSPSEVSVVFDESYDRVPHPDNNLENSISEIWDSRVQINKSLFNGQKFRYGGHIMRGEGGSSVESHVCLHLGLTDYRTFVGTNLNPLWEKFLVPSEDDVIQCQHTASPLGNGAVVETSDKKILLLQRSNNVGEFPGHFVFPGGHPEPQDAGITSHPCGSTDSEFINHKVSQEMFDSITREVVEEIGVPSESLVSYSLLIRYQVVVPALLLCGYMCTST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nudix hydrolase 9 Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.probableQ8VYR2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RYA, chain A
Confidence level:confident
Coverage over the Query: 127-168,191-235
View the alignment between query and template
View the model in PyMOL
Template: 3FSP, chain A
Confidence level:confident
Coverage over the Query: 14-168,191-235
View the alignment between query and template
View the model in PyMOL
Template: 3QSJ, chain A
Confidence level:confident
Coverage over the Query: 139-208
View the alignment between query and template
View the model in PyMOL