Citrus Sinensis ID: 026590

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MIISSKTATLTQNSSSMAHLANLNGVSETLPAVPNLPKFQKFPKRAKIIGLLGHKAENFQDQAQITRRVSLGLASLALIGSTSTNGVSLAEDNGLWVTGPLPVPPVYNNIANEKTGTRSFLKKAIYIANIGTKGRIHRLKRYAFDLLAMADLIGPDTLNYVRKYLRLKSTFMYYDFDNVISAAAPTDKQPLTDLANRLFESFEKLEVAVSTKNFPQTQSTYADTAVILHEVMDRMA
ccccccccHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHc
********TLTQNSSSMAHLANLNGVSETL*AVPNLPKFQKFPKRAKIIGLLGHKAENFQDQAQITRRVSLGLASLALIGSTSTNGVSLAEDNGLWVTGPLPVPPVYNNIANEKTGTRSFLKKAIYIANIGTKGRIHRLKRYAFDLLAMADLIGPDTLNYVRKYLRLKSTFMYYDFDNVISAAAPTDKQPLTDLANRLFESFEKLEVAVSTKNFPQTQSTYADTAVILHEVMDRMA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIISSKTATLTQNSSSMAHLANLNGVSETLPAVPNLPKFQKFPKRAKIIGLLGHKAENFQDQAQITRRVSLGLASLALIGSTSTNGVSLAEDNGLWVTGPLPVPPVYNNIANEKTGTRSFLKKAIYIANIGTKGRIHRLKRYAFDLLAMADLIGPDTLNYVRKYLRLKSTFMYYDFDNVISAAAPTDKQPLTDLANRLFESFEKLEVAVSTKNFPQTQSTYADTAVILHEVMDRMA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PsbQ-like protein 2, chloroplastic Required for both formation and activity of the chloroplast NAD(P)H dehydrogenase (NDH) complex.probableQ9SGH4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VYK, chain A
Confidence level:very confident
Coverage over the Query: 121-236
View the alignment between query and template
View the model in PyMOL