Citrus Sinensis ID: 026596


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MANGVEKESVLMMFSDEELREISGVKRGGDYIEVTCGCTSHRYGDAVGRLRVFSNGDLEITCECTPGCNEDKMTPGAFEKHSGRETARKWKNNVWVIANGEKVPLSKTVLLKYYNQASKHGNGSHRSHNGRVCHRDEFVRCARCNKERRFRLRTKEECLIHHNALADKNWKCSDLPYDKITCDDEEERASRRVYRGCIRSPTCKGCTSCVCFGCDICRFSDCSCQTCIDFTRNAKT
cccccccccccccccHHHHHHHHccCCcccEEEEEEccccccccccEEEEEEECcccEEEEEEcccccccccccHHHHHHcccccccccccccEEEEEcccCCcccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHccccccccccccccEEECcccEEEEccccccHHHHHHHHccc
************MFSDEELREISGVKRGGDYIEVTCGCTSHRYGDAVGRLRVFSNGDLEITCECTPGCNEDKMT************ARKWKNNVWVIANGEKVPLSKTVLLKYYNQA**************VCHRDEFVRCARCNKERRFRLRTKEECLIHHNALADKNWKCSDLPYDKITCDDEEERAS******CIRSPTCKGCTSCVCFGCDICRFSDCSCQTCIDFTRNA**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANGVEKESVLMMFSDEELREISGVKRGGDYIEVTCGCTSHRYGDAVGRLRVFSNGDLEITCECTPGCNEDKMTPGAFEKHSGRETARKWKNNVWVIANGEKVPLSKTVLLKYYNQASKHGNGSHRSHNGRVCHRDEFVRCARCNKERRFRLRTKEECLIHHNALADKNWKCSDLPYDKITCDDEEERASRRVYRGCIRSPTCKGCTSCVCFGCDICRFSDCSCQTCIDFTRNAKT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein ULTRAPETALA 1 Putative transcription factor that acts as a key negative regulator of cell accumulation in shoot and floral meristems. Negatively regulates the size of the WUSCHEL (WUS)-expressing organizing center in inflorescence meristems. May act by down-regulating expression of WUS.confidentQ8GZA8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E61, chain A
Confidence level:probable
Coverage over the Query: 131-187
View the alignment between query and template
View the model in PyMOL
Template: 1OQJ, chain A
Confidence level:probable
Coverage over the Query: 72-119
View the alignment between query and template
View the model in PyMOL