Citrus Sinensis ID: 026598

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------

MFSSNLIGFILAVVSSAFIGSSFIIKKKGLRKAGANGARAGSGGYGYLLEPLWWVGMFTMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFMLNEKLQKMGMLGCLLCVVGSTMIVLHAPLEESLNSVQEIWVLATQPAFLLYVGSVVAVALVLILYCAPRYGQTNILIYIGICSVIGSLTVMSVKAIGIAIKLTLEGLNQAKCIETWIFAMVALTCVITQLNYLNMVSVL

cccccHHHHHHHHHHHHHHHHHHHEEHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHccccccccccEEEEEccEEEEEccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccccHHEEEEEEHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc

*FSSNLIGFILAVVSSAFIGSSFIIKKKGLR*******RAGSGGYGYLLEPLWWVGMFTMIVGEIANFVAYIYAPAVLVTPLGALSIIVSAVLAHFMLNEKLQKMGMLGCLLCVVGSTMIVLHAPLEESLNSVQEIWVLATQPAFLLYVGSVVAVALVLILYCAPRYGQTNILIYIGICSVIGSLTVMSVKAIGIAIKLTLEGLNQAKCIETWIFAMVALTCVITQLNYLNMVSVL

xxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxHHHHHHHxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Magnesium transporter NIPA2	Acts as a selective Mg(2+) transporter.	probable	Q3SWX0
Magnesium transporter NIPA2	Acts as a selective Mg(2+) transporter.	probable	Q5R7Q3
Magnesium transporter NIPA2	Acts as a selective Mg(2+) transporter.	probable	Q8N8Q9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 11-26,54-123
View the alignment between query and template
View the model in PyMOL