Citrus Sinensis ID: 026605


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MGANSLSTDTTTDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVGCPLQLKLLIISGTLIVFKRFLMKGPCVICYGLTQMIDVVGVSHLVVLDILLARTYLNNSIIQTT
cccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccEEccccEEEEccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHccccHHHHHHHHHcccccccEEEcccEEEEEcccccccHHHHHHcccccccccccccEEEEccccccccccEEEEEEcHHHHHHHHHHHccccccc
cccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccEEEEcccEEEEcEccccHHHHHHHHHHHcccccccEEEccccccccccHHHHHHHHHHHHHHccccEEEcccccccHHHHccccHHHHHHHHcccHHHHHHHHHHHccccEEEEEcccEEEEcccccccccHHHHHHcccccccccccccccccccccccccccccEcccHHHHHHHHHccccEEEEc
mganslstdttTDLDEQISQlmqckplsepqVKALCEKAKEILMEesnvqpvkspvticgdihgQFHDLAELFQiggkcpdtnylfmgdyvdrgyYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANIWKIFTDLfdyfpltalsqkysvcmvgcpLQLKLLIISGTLIVFKRFLMKGPCVICYGLTQMIDVVGVSHLVVLDILLARTYLNNSIIQTT
mganslstdtttdldEQISQLmqckplsepQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRItilrgnhesrqiTQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVGCPLQLKLLIISGTLIVFKRFLMKGPCVICYGLTQMIDVVGVSHLVVLDILLArtylnnsiiqtt
MGANslstdtttdldEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVGCPLQLKLLIISGTLIVFKRFLMKGPCVICYGLTQMIDVVGVSHLVVLDILLARTYLNNSIIQTT
***********************************C*****IL*****VQPVKSPVTICGDIHGQFHDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVGCPLQLKLLIISGTLIVFKRFLMKGPCVICYGLTQMIDVVGVSHLVVLDILLARTYLNNSII***
**************DEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVGCPLQLKLLIISGTLIVFKRFLMKGPCVICYGLTQMIDVVGVSHLVVLDILLARTYLNNSII***
************DLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVGCPLQLKLLIISGTLIVFKRFLMKGPCVICYGLTQMIDVVGVSHLVVLDILLARTYLNNSIIQTT
**********TTDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVGCPLQLKLLIISGTLIVFKRFLMKGPCVICYGLTQMIDVVGVSHLVVLDILLARTYLNNSIIQTT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGANSLSTDTTTDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVGCPLQLKLLIISGTLIVFKRFLMKGPCVICYGLTQMIDVVGVSHLVVLDILLARTYLNNSIIQTT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query236 2.2.26 [Sep-21-2011]
P48578313 Serine/threonine-protein yes no 0.728 0.549 0.901 4e-89
Q07100313 Serine/threonine-protein yes no 0.728 0.549 0.889 3e-88
Q06009313 Serine/threonine-protein N/A no 0.728 0.549 0.877 7e-87
P23778309 Serine/threonine-protein N/A no 0.711 0.543 0.875 4e-84
Q9XGH7312 Serine/threonine-protein N/A no 0.703 0.532 0.867 2e-83
O04860314 Serine/threonine-protein N/A no 0.677 0.509 0.893 4e-83
Q10BT5307 Serine/threonine-protein yes no 0.673 0.517 0.893 2e-82
A2XN40307 Serine/threonine-protein N/A no 0.673 0.517 0.893 2e-82
A3C4N5314 Serine/threonine-protein no no 0.673 0.506 0.886 7e-82
P0C5D7315 Putative serine/threonine N/A no 0.673 0.504 0.880 9e-81
>sp|P48578|PP2A3_ARATH Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Arabidopsis thaliana GN=PP2A3 PE=2 SV=1 Back     alignment and function desciption
 Score =  327 bits (839), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 155/172 (90%), Positives = 161/172 (93%)

Query: 1   MGANSLSTDTTTDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICG 60
           MGANSL TD T DLDEQISQLMQCKPLSE QV+ALCEKAKEILM+ESNVQPVKSPVTICG
Sbjct: 1   MGANSLPTDATLDLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICG 60

Query: 61  DIHGQFHDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRG 120
           DIHGQFHDLAELF+IGGKCPDTNYLFMGDYVDRGYYSVETVTLLV LKVRYPQRITILRG
Sbjct: 61  DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVGLKVRYPQRITILRG 120

Query: 121 NHESRQITQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVG 172
           NHESRQITQVYGFYDECLRKYGNAN+WKIFTDLFDYFPLTAL +    C+ G
Sbjct: 121 NHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHG 172





Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q07100|PP2A4_ARATH Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Arabidopsis thaliana GN=PP2A4 PE=2 SV=2 Back     alignment and function description
>sp|Q06009|PP2A_MEDSA Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Medicago sativa GN=PP2A PE=2 SV=1 Back     alignment and function description
>sp|P23778|PP2A_BRANA Serine/threonine-protein phosphatase PP2A catalytic subunit (Fragment) OS=Brassica napus PE=2 SV=2 Back     alignment and function description
>sp|Q9XGH7|PP2A_TOBAC Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Nicotiana tabacum PE=2 SV=1 Back     alignment and function description
>sp|O04860|PP2A5_TOBAC Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Nicotiana tabacum GN=NPP5 PE=2 SV=1 Back     alignment and function description
>sp|Q10BT5|PP2A2_ORYSJ Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A2 PE=2 SV=1 Back     alignment and function description
>sp|A2XN40|PP2A2_ORYSI Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A2 PE=2 SV=2 Back     alignment and function description
>sp|A3C4N5|PP2A4_ORYSJ Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A4 PE=2 SV=2 Back     alignment and function description
>sp|P0C5D7|PP2A4_ORYSI Putative serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
226530458232 PP2Ac-2 - Phosphatase 2A isoform 2 belon 0.932 0.948 0.774 4e-92
11262975299 phosphoprotein phosphatase (EC 3.1.3.16) 0.728 0.575 0.901 1e-87
18410971313 serine/threonine-protein phosphatase PP2 0.728 0.549 0.901 2e-87
255580686313 protein phsophatase-2a, putative [Ricinu 0.728 0.549 0.889 4e-87
4204947 352 serine/threonine protein phosphatase 2A- 0.728 0.488 0.883 7e-87
18405985313 serine/threonine-protein phosphatase PP2 0.728 0.549 0.889 2e-86
224138154313 predicted protein [Populus trichocarpa] 0.728 0.549 0.883 4e-86
224091552313 predicted protein [Populus trichocarpa] 0.728 0.549 0.872 2e-85
358348144313 Serine/threonine protein phosphatase [Me 0.728 0.549 0.877 4e-85
356500389314 PREDICTED: serine/threonine-protein phos 0.728 0.547 0.872 1e-84
>gi|226530458|ref|NP_001150187.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea mays] gi|195637408|gb|ACG38172.1| PP2Ac-2 - Phosphatase 2A isoform 2 belonging to family 2 [Zea mays] Back     alignment and taxonomy information
 Score =  343 bits (879), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 172/222 (77%), Positives = 185/222 (83%), Gaps = 2/222 (0%)

Query: 14  LDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELF 73
           LD+QI +LMQCKPL+EP+V+ALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELF
Sbjct: 8   LDDQIERLMQCKPLAEPEVRALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELF 67

Query: 74  QIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGF 133
           +IGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGF
Sbjct: 68  RIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGF 127

Query: 134 YDECLRKYGNANIWKIFTDLFDYFPLTAL--SQKYSVCMVGCPLQLKLLIISGTLIVFKR 191
           YDECLRKYGNAN+WK FTDLFDYFPLTAL  S+ +  CMV     L+    S TL   K+
Sbjct: 128 YDECLRKYGNANVWKTFTDLFDYFPLTALVESEIFFACMVDYRHPLRPSTTSATLTASKK 187

Query: 192 FLMKGPCVICYGLTQMIDVVGVSHLVVLDILLARTYLNNSII 233
           FL K  CVI  GL QMI V GV  LVVL I   R Y ++S I
Sbjct: 188 FLTKVQCVIFCGLIQMIGVAGVFLLVVLVIPSDRIYQSSSTI 229




Source: Zea mays

Species: Zea mays

Genus: Zea

Family: Poaceae

Order: Poales

Class: Liliopsida

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|11262975|pir||T45670 phosphoprotein phosphatase (EC 3.1.3.16) 2A-4 (version 2) [similarity] - Arabidopsis thaliana gi|6735367|emb|CAB68188.1| phosphoprotein phosphatase 2A isoform 4 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18410971|ref|NP_567066.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit [Arabidopsis thaliana] gi|297820682|ref|XP_002878224.1| protein phosphatase 2A-3 [Arabidopsis lyrata subsp. lyrata] gi|1352664|sp|P48578.1|PP2A3_ARATH RecName: Full=Serine/threonine-protein phosphatase PP2A-3 catalytic subunit; AltName: Full=Protein phosphatase 2A isoform 3 gi|473259|gb|AAA64941.1| Ser/Thr protein phosphatase [Arabidopsis thaliana] gi|4204949|gb|AAD10855.1| serine/threonine protein phosphatase 2A-4 catalytic subunit [Arabidopsis thaliana] gi|15810367|gb|AAL07071.1| putative phosphoprotein phosphatase 2A isoform 4 [Arabidopsis thaliana] gi|16209682|gb|AAL14399.1| AT3g58500/F14P22_90 [Arabidopsis thaliana] gi|21360431|gb|AAM47331.1| AT3g58500/F14P22_90 [Arabidopsis thaliana] gi|297324062|gb|EFH54483.1| protein phosphatase 2A-3 [Arabidopsis lyrata subsp. lyrata] gi|332646269|gb|AEE79790.1| serine/threonine-protein phosphatase PP2A-3 catalytic subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255580686|ref|XP_002531165.1| protein phsophatase-2a, putative [Ricinus communis] gi|223529235|gb|EEF31208.1| protein phsophatase-2a, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|4204947|gb|AAD10854.1| serine/threonine protein phosphatase 2A-3 catalytic subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18405985|ref|NP_565974.1| serine/threonine-protein phosphatase PP2A-4 catalytic subunit [Arabidopsis thaliana] gi|297827949|ref|XP_002881857.1| protein phosphatase 2A-4 [Arabidopsis lyrata subsp. lyrata] gi|1352663|sp|Q07100.2|PP2A4_ARATH RecName: Full=Serine/threonine-protein phosphatase PP2A-4 catalytic subunit; AltName: Full=Protein phosphatase 2A isoform 4 gi|466441|gb|AAA64742.1| Ser/Thr protein phosphatase [Arabidopsis thaliana] gi|4567320|gb|AAD23731.1| serine threonine protein phosphatase PP2A-3 catalytic subunit [Arabidopsis thaliana] gi|20198072|gb|AAM15383.1| serine/threonine protein phosphatase PP2A-3 catalytic subunit [Arabidopsis thaliana] gi|33589738|gb|AAQ22635.1| At2g42500/F14N22.23 [Arabidopsis thaliana] gi|297327696|gb|EFH58116.1| protein phosphatase 2A-4 [Arabidopsis lyrata subsp. lyrata] gi|330255033|gb|AEC10127.1| serine/threonine-protein phosphatase PP2A-4 catalytic subunit [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224138154|ref|XP_002322743.1| predicted protein [Populus trichocarpa] gi|222867373|gb|EEF04504.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224091552|ref|XP_002309283.1| predicted protein [Populus trichocarpa] gi|222855259|gb|EEE92806.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|358348144|ref|XP_003638109.1| Serine/threonine protein phosphatase [Medicago truncatula] gi|548441|sp|Q06009.1|PP2A_MEDSA RecName: Full=Serine/threonine-protein phosphatase PP2A catalytic subunit gi|287811|emb|CAA49849.1| phosphoprotein phosphatase type 2A [Medicago sativa] gi|355504044|gb|AES85247.1| Serine/threonine protein phosphatase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356500389|ref|XP_003519014.1| PREDICTED: serine/threonine-protein phosphatase PP2A-3 catalytic subunit-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
TAIR|locus:2076451313 PP2A-4 "protein phosphatase 2A 0.728 0.549 0.854 7.9e-78
TAIR|locus:2041579313 PP2A-3 "AT2G42500" [Arabidopsi 0.728 0.549 0.848 2.7e-77
DICTYBASE|DDB_G0290263306 pho2a "protein phosphatase 2A 0.656 0.506 0.793 8.2e-67
UNIPROTKB|P48463309 PPP2CA "Serine/threonine-prote 0.656 0.501 0.806 8.2e-67
UNIPROTKB|E2QV40311 PPP2CB "Uncharacterized protei 0.656 0.498 0.802 8.2e-67
UNIPROTKB|P67774309 PPP2CA "Serine/threonine-prote 0.656 0.501 0.812 1.7e-66
UNIPROTKB|Q0P594309 PPP2CB "Serine/threonine-prote 0.656 0.501 0.8 1.7e-66
UNIPROTKB|F1P7I7309 PPP2CA "Serine/threonine-prote 0.656 0.501 0.812 1.7e-66
UNIPROTKB|F6X958309 PPP2CB "Serine/threonine-prote 0.656 0.501 0.8 1.7e-66
UNIPROTKB|P62714309 PPP2CB "Serine/threonine-prote 0.656 0.501 0.8 1.7e-66
TAIR|locus:2076451 PP2A-4 "protein phosphatase 2A-4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 783 (280.7 bits), Expect = 7.9e-78, P = 7.9e-78
 Identities = 147/172 (85%), Positives = 153/172 (88%)

Query:     1 MGANXXXXXXXXXXXEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICG 60
             MGAN           EQISQLMQCKPLSE QV+ALCEKAKEILM+ESNVQPVKSPVTICG
Sbjct:     1 MGANSLPTDATLDLDEQISQLMQCKPLSEQQVRALCEKAKEILMDESNVQPVKSPVTICG 60

Query:    61 DIHGQFHDLAELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRG 120
             DIHGQFHDLAELF+IGGKCPDTNYLFMGDYVDRGYYSVETVTLLV LKVRYPQRITILRG
Sbjct:    61 DIHGQFHDLAELFRIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVGLKVRYPQRITILRG 120

Query:   121 NHESRQITQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVG 172
             NHESRQITQVYGFYDECLRKYGNAN+WKIFTDLFDYFPLTAL +    C+ G
Sbjct:   121 NHESRQITQVYGFYDECLRKYGNANVWKIFTDLFDYFPLTALVESEIFCLHG 172




GO:0005737 "cytoplasm" evidence=ISM;IDA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0005730 "nucleolus" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0000159 "protein phosphatase type 2A complex" evidence=TAS
GO:0006470 "protein dephosphorylation" evidence=TAS
GO:0004722 "protein serine/threonine phosphatase activity" evidence=ISS
TAIR|locus:2041579 PP2A-3 "AT2G42500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290263 pho2a "protein phosphatase 2A subunit C" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|P48463 PPP2CA "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QV40 PPP2CB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P67774 PPP2CA "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q0P594 PPP2CB "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P7I7 PPP2CA "Serine/threonine-protein phosphatase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6X958 PPP2CB "Serine/threonine-protein phosphatase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P62714 PPP2CB "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P11611PP2AB_RABIT3, ., 1, ., 3, ., 1, 60.78390.68640.5242yesno
P48463PP2AA_CHICK3, ., 1, ., 3, ., 1, 60.79370.67790.5177yesno
Q9HFQ2PP2A1_EMENI3, ., 1, ., 3, ., 1, 60.77980.67370.4832yesno
P23636PP2A2_SCHPO3, ., 1, ., 3, ., 1, 60.73000.69060.5062yesno
P62716PP2AB_RAT3, ., 1, ., 3, ., 1, 60.78390.68640.5242yesno
P62714PP2AB_HUMAN3, ., 1, ., 3, ., 1, 60.78390.68640.5242yesno
P62715PP2AB_MOUSE3, ., 1, ., 3, ., 1, 60.78390.68640.5242yesno
P23696PP2A_DROME3, ., 1, ., 3, ., 1, 60.78520.69060.5275yesno
P63331PP2AA_RAT3, ., 1, ., 3, ., 1, 60.79620.68640.5242yesno
P63330PP2AA_MOUSE3, ., 1, ., 3, ., 1, 60.79620.68640.5242yesno
Q07100PP2A4_ARATH3, ., 1, ., 3, ., 1, 60.88950.72880.5495yesno
P67777PP2AA_RABIT3, ., 1, ., 3, ., 1, 60.79620.68640.5242yesno
P67776PP2AA_PIG3, ., 1, ., 3, ., 1, 60.79620.68640.5242yesno
P67775PP2AA_HUMAN3, ., 1, ., 3, ., 1, 60.79620.68640.5242yesno
P67774PP2AA_BOVIN3, ., 1, ., 3, ., 1, 60.79620.68640.5242yesno
P48578PP2A3_ARATH3, ., 1, ., 3, ., 1, 60.90110.72880.5495yesno
Q0P594PP2AB_BOVIN3, ., 1, ., 3, ., 1, 60.79010.68640.5242yesno
Q9XZE5PP2AA_DICDI3, ., 1, ., 3, ., 1, 60.78120.67790.5228yesno
P11493PP2AB_PIG3, ., 1, ., 3, ., 1, 60.80920.64400.5187yesno
Q10BT5PP2A2_ORYSJ3, ., 1, ., 3, ., 1, 60.89300.67370.5179yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.946
3rd Layer3.1.30.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
cd07415285 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos 1e-114
PTZ00239303 PTZ00239, PTZ00239, serine/threonine protein phosp 9e-83
smart00156271 smart00156, PP2Ac, Protein phosphatase 2A homologu 2e-72
cd07414293 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li 4e-61
cd07416305 cd07416, MPP_PP2B, PP2B, metallophosphatase domain 4e-53
PTZ00480320 PTZ00480, PTZ00480, serine/threonine-protein phosp 7e-50
cd07419311 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho 7e-45
PTZ00244294 PTZ00244, PTZ00244, serine/threonine-protein phosp 3e-40
cd07417316 cd07417, MPP_PP5_C, PP5, C-terminal metallophospha 1e-39
cd00144225 cd00144, MPP_PPP_family, phosphoprotein phosphatas 1e-36
cd07418 377 cd07418, MPP_PP7, PP7, metallophosphatase domain 1e-32
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 6e-26
cd07420321 cd07420, MPP_RdgC, Drosophila melanogaster RdgC an 9e-24
cd07421 304 cd07421, MPP_Rhilphs, Rhilph phosphatases, metallo 3e-07
COG0639155 COG0639, ApaH, Diadenosine tetraphosphatase and re 3e-05
cd07424207 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophos 4e-05
cd07413222 cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 9e-05
cd00838131 cd00838, MPP_superfamily, metallophosphatase super 1e-04
PHA02239235 PHA02239, PHA02239, putative protein phosphatase 5e-04
TIGR04075 851 TIGR04075, bacter_Pnkp, polynucleotide kinase-phos 7e-04
PRK09968218 PRK09968, PRK09968, serine/threonine-specific prot 7e-04
cd07425208 cd07425, MPP_Shelphs, Shewanella-like phosphatases 0.002
cd07423234 cd07423, MPP_PrpE, Bacillus subtilis PrpE and rela 0.003
>gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
 Score =  327 bits (840), Expect = e-114
 Identities = 117/150 (78%), Positives = 133/150 (88%)

Query: 13  DLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAEL 72
           DLD+ I QL +C+ L E +VK+LCEKAKEIL++ESNVQ V+SPVT+CGDIHGQF+DL EL
Sbjct: 1   DLDKWIEQLKKCELLPESEVKSLCEKAKEILVKESNVQRVRSPVTVCGDIHGQFYDLLEL 60

Query: 73  FQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYG 132
           F++GG  PDTNYLF+GDYVDRGYYSVET  LL+ALKVRYP RIT+LRGNHESRQITQVYG
Sbjct: 61  FRVGGDPPDTNYLFLGDYVDRGYYSVETFLLLLALKVRYPDRITLLRGNHESRQITQVYG 120

Query: 133 FYDECLRKYGNANIWKIFTDLFDYFPLTAL 162
           FYDECLRKYGNAN+WK  TDLFDY PL AL
Sbjct: 121 FYDECLRKYGNANVWKYCTDLFDYLPLAAL 150


PP2A-like family of phosphoprotein phosphatases (PPP's) including PP4 and PP6. PP2A (Protein phosphatase 2A) is a critical regulator of many cellular activities. PP2A comprises about 1% of total cellular proteins. PP2A, together with protein phosphatase 1 (PP1), accounts for more than 90% of all serine/threonine phosphatase activities in most cells and tissues. The PP2A subunit in addition to having a catalytic domain homologous to PP1, has a unique C-terminal tail, containing a motif that is conserved in the catalytic subunits of all PP2A-like phosphatases including PP4 and PP6, and has an important role in PP2A regulation. The PP2A-like family of phosphatases all share a similar heterotrimeric architecture, that includes: a 65kDa scaffolding subunit (A), a 36kDa catalytic subunit (C), and one of 18 regulatory subunits (B). The PPP (phosphoprotein phosphatase) family, to which PP2A belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 285

>gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>gnl|CDD|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163661 cd07418, MPP_PP7, PP7, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|163663 cd07420, MPP_RdgC, Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163664 cd07421, MPP_Rhilphs, Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|223712 COG0639, ApaH, Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163667 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163656 cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|107154 PHA02239, PHA02239, putative protein phosphatase Back     alignment and domain information
>gnl|CDD|234457 TIGR04075, bacter_Pnkp, polynucleotide kinase-phosphatase Back     alignment and domain information
>gnl|CDD|182173 PRK09968, PRK09968, serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>gnl|CDD|163668 cd07425, MPP_Shelphs, Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163666 cd07423, MPP_PrpE, Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 236
KOG0372303 consensus Serine/threonine specific protein phosph 100.0
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 100.0
KOG0373306 consensus Serine/threonine specific protein phosph 100.0
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 100.0
KOG0371319 consensus Serine/threonine protein phosphatase 2A, 100.0
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 100.0
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 100.0
PTZ00480320 serine/threonine-protein phosphatase; Provisional 100.0
KOG0374331 consensus Serine/threonine specific protein phosph 100.0
KOG0375 517 consensus Serine-threonine phosphatase 2B, catalyt 100.0
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 100.0
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 100.0
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 100.0
cd07418 377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 100.0
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 100.0
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 100.0
TIGR00668279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 99.98
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 99.97
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 99.97
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 99.97
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 99.96
cd07422257 MPP_ApaH Escherichia coli ApaH and related protein 99.96
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 99.96
KOG0377 631 consensus Protein serine/threonine phosphatase RDG 99.95
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 99.93
PRK09968218 serine/threonine-specific protein phosphatase 2; P 99.93
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 99.93
PHA02239235 putative protein phosphatase 99.92
cd07421304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 99.92
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 99.91
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 99.82
PRK09453182 phosphodiesterase; Provisional 99.61
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 99.51
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 99.45
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 99.39
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 99.39
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 99.24
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 99.22
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 99.14
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 99.08
PRK11340271 phosphodiesterase YaeI; Provisional 99.01
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 98.92
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 98.91
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 98.88
cd00838131 MPP_superfamily metallophosphatase superfamily, me 98.86
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 98.78
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 98.74
COG0622172 Predicted phosphoesterase [General function predic 98.68
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 98.65
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 98.64
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 98.63
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 98.6
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 98.56
PRK04036504 DNA polymerase II small subunit; Validated 98.5
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 98.43
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 98.38
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 98.36
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 98.35
PHA02546 340 47 endonuclease subunit; Provisional 98.32
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 98.3
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 98.29
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 98.2
PRK10966 407 exonuclease subunit SbcD; Provisional 98.12
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 98.11
TIGR00583 405 mre11 DNA repair protein (mre11). All proteins in 98.09
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 98.05
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 97.94
cd00844262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 97.92
COG1409 301 Icc Predicted phosphohydrolases [General function 97.91
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 97.88
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 97.85
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 97.84
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 97.84
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 97.78
COG2129226 Predicted phosphoesterases, related to the Icc pro 97.73
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 97.72
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 97.68
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 97.68
cd00839 294 MPP_PAPs purple acid phosphatases of the metalloph 97.62
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 97.61
COG1408284 Predicted phosphohydrolases [General function pred 97.59
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 97.51
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 97.45
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 97.44
COG2908237 Uncharacterized protein conserved in bacteria [Fun 97.14
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 97.09
PLN02533 427 probable purple acid phosphatase 96.91
COG1407235 Predicted ICC-like phosphoesterases [General funct 96.85
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 96.73
COG1768230 Predicted phosphohydrolase [General function predi 96.61
cd07408257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 96.53
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 96.43
cd07412288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 96.41
cd07411264 MPP_SoxB_N Thermus thermophilus SoxB and related p 96.27
PF0832195 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 95.83
cd07406257 MPP_CG11883_N Drosophila melanogaster CG11883 and 95.55
cd07409281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 95.5
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 95.45
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 95.37
KOG1432 379 consensus Predicted DNA repair exonuclease SIA1 [G 95.17
TIGR00282266 metallophosphoesterase, MG_246/BB_0505 family. A m 95.1
cd00842296 MPP_ASMase acid sphingomyelinase and related prote 94.64
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 94.3
KOG2863 456 consensus RNA lariat debranching enzyme [RNA proce 94.13
cd07405285 MPP_UshA_N Escherichia coli UshA and related prote 94.0
cd08162 313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 93.9
KOG3325183 consensus Membrane coat complex Retromer, subunit 93.84
KOG3662 410 consensus Cell division control protein/predicted 93.73
cd07407282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 93.53
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 93.51
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 93.51
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 93.4
cd07382255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 93.2
PF06874 640 FBPase_2: Firmicute fructose-1,6-bisphosphatase; I 93.17
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 92.87
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 92.13
KOG2476 528 consensus Uncharacterized conserved protein [Funct 92.05
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 91.04
PF04042209 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit 90.35
KOG2310 646 consensus DNA repair exonuclease MRE11 [Replicatio 90.27
PTZ00422 394 glideosome-associated protein 50; Provisional 89.99
PRK09418 780 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 88.86
COG3855 648 Fbp Uncharacterized protein conserved in bacteria 88.16
cd07387257 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2 88.12
KOG1378 452 consensus Purple acid phosphatase [Carbohydrate tr 86.97
KOG2679336 consensus Purple (tartrate-resistant) acid phospha 85.38
PRK09558 551 ushA bifunctional UDP-sugar hydrolase/5'-nucleotid 83.81
PTZ00235291 DNA polymerase epsilon subunit B; Provisional 82.98
KOG3947305 consensus Phosphoesterases [General function predi 81.1
COG0639155 ApaH Diadenosine tetraphosphatase and related seri 80.72
>KOG0372 consensus Serine/threonine specific protein phosphatase involved in glycogen accumulation, PP2A-related [Carbohydrate transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=2.9e-44  Score=297.41  Aligned_cols=165  Identities=66%  Similarity=1.157  Sum_probs=161.7

Q ss_pred             CHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhcCCccccCCceeEecCCCccHHHHHHHHHhcCCCCCceEEEeccccC
Q 026605           13 DLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFQIGGKCPDTNYLFMGDYVD   92 (236)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~e~~~~~~~~~i~vigDIHG~~~~L~~ll~~~~~~~~~~~v~LGD~vd   92 (236)
                      ++|+.|+++.++..+++.++..||.++.+++.+|+|++.+..|+.|+|||||++.+|..+|+..+..+..+++|||||||
T Consensus         2 dldr~ie~L~~~~li~E~eV~~LC~~~~eiL~~E~NV~~i~tPvtvcGDIHGQf~Dllelf~igG~~~~t~YLFLGDyVD   81 (303)
T KOG0372|consen    2 DLDRQIEQLRRCELIAESEVKALCAKVREILVEESNVQRIDTPVTVCGDIHGQFYDLLELFRIGGDVPETNYLFLGDYVD   81 (303)
T ss_pred             cHHHHHHHHHhcCCCcHHHHHHHHHHHHHHHhcCCCceecCCCcEEeecccchHHHHHHHHHhCCCCCCCceEeecchhc
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHHHHHHHHHhhhhCCCCeEEEccCccccccccccCcHHHHHHHhCCchhHHHHHHHhccCcceEEECcEEEEEeC
Q 026605           93 RGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVG  172 (236)
Q Consensus        93 rG~~s~e~l~~l~~lk~~~p~~v~~lrGNHE~~~~~~~~~f~~e~~~~~~~~~l~~~~~~~~~~LP~~~~~~~~~~~~hg  172 (236)
                      ||.+|+|++.+|..+|.+||+++.+||||||.+.++..|||++||.+|||+..+|....+.|+.||+++++++++||+||
T Consensus        82 RG~~SvEt~lLLl~lK~rYP~ritLiRGNHEsRqitqvYGFY~EclrKYG~~~vWr~c~eiFdyL~l~aiid~kifCVHG  161 (303)
T KOG0372|consen   82 RGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGSANVWRYCTEIFDYLSLAAIIDGKIFCVHG  161 (303)
T ss_pred             cccchHHHHHHHHHHhhcCcceeEEeeccchhhhhhhhhhHHHHHHHHcCChHHHHHHHHHHHhhhHhheecCcEEEEcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccc
Q 026605          173 CPLQL  177 (236)
Q Consensus       173 ~~~~~  177 (236)
                      +.+|.
T Consensus       162 GlSP~  166 (303)
T KOG0372|consen  162 GLSPS  166 (303)
T ss_pred             CCCcc
Confidence            98765



>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG0373 consensus Serine/threonine specific protein phosphatase involved in cell cycle control, PP2A-related [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>KOG0371 consensus Serine/threonine protein phosphatase 2A, catalytic subunit [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>KOG0374 consensus Serine/threonine specific protein phosphatase PP1, catalytic subunit [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG0375 consensus Serine-threonine phosphatase 2B, catalytic subunit [General function prediction only] Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PF08321 PPP5: PPP5 TPR repeat region; InterPro: IPR013235 This domain is specific to the PPP5 subfamily of serine/threonine phosphatases Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1432 consensus Predicted DNA repair exonuclease SIA1 [General function prediction only] Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2863 consensus RNA lariat debranching enzyme [RNA processing and modification] Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>KOG3325 consensus Membrane coat complex Retromer, subunit VPS29/PEP11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3662 consensus Cell division control protein/predicted DNA repair exonuclease [Replication, recombination and repair] Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>KOG2476 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>PF04042 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit B; InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast Back     alignment and domain information
>KOG2310 consensus DNA repair exonuclease MRE11 [Replication, recombination and repair] Back     alignment and domain information
>PTZ00422 glideosome-associated protein 50; Provisional Back     alignment and domain information
>PRK09418 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>COG3855 Fbp Uncharacterized protein conserved in bacteria [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain Back     alignment and domain information
>KOG1378 consensus Purple acid phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2679 consensus Purple (tartrate-resistant) acid phosphatase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09558 ushA bifunctional UDP-sugar hydrolase/5'-nucleotidase periplasmic precursor; Reviewed Back     alignment and domain information
>PTZ00235 DNA polymerase epsilon subunit B; Provisional Back     alignment and domain information
>KOG3947 consensus Phosphoesterases [General function prediction only] Back     alignment and domain information
>COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
2nyl_C293 Crystal Structure Of Protein Phosphatase 2a (Pp2a) 6e-72
3p71_C304 Crystal Structure Of The Complex Of Lcmt-1 And Pp2a 6e-72
2ie3_C309 Structure Of The Protein Phosphatase 2a Core Enzyme 6e-72
3c5w_C310 Complex Between Pp2a-Specific Methylesterase Pme-1 7e-72
2ie4_C309 Structure Of The Protein Phosphatase 2a Core Enzyme 7e-72
2iae_C309 Crystal Structure Of A Protein Phosphatase 2a (Pp2a 2e-71
3fga_C309 Structural Basis Of Pp2a And Sgo Interaction Length 2e-71
3n5u_B300 Crystal Structure Of An Rb C-Terminal Peptide Bound 1e-39
3e7a_A299 Crystal Structure Of Protein Phosphatase-1 Bound To 1e-39
3v4y_A306 Crystal Structure Of The First Nuclear Pp1 Holoenzy 1e-39
1u32_A293 Crystal Structure Of A Protein Phosphatase-1: Calci 2e-39
4g9j_A331 Protein SerTHR PHOSPHATASE-1 In Complex With Cell-P 2e-39
1fjm_A330 Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isofor 2e-39
3egg_A329 Crystal Structure Of A Complex Between Protein Phos 2e-39
2o8a_A329 Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Leng 2e-39
1jk7_A323 Crystal Structure Of The Tumor-Promoter Okadaic Aci 2e-39
1s70_A330 Complex Between Protein Ser/thr Phosphatase-1 (delt 7e-39
1aui_A 521 Human Calcineurin Heterodimer Length = 521 3e-33
3ll8_A 357 Crystal Structure Of Calcineurin In Complex With Ak 4e-33
1m63_A 372 Crystal Structure Of Calcineurin-Cyclophilin-Cyclos 4e-33
1mf8_A 373 Crystal Structure Of Human Calcineurin Complexed Wi 4e-33
2p6b_A 383 Crystal Structure Of Human Calcineurin In Complex W 4e-33
1tco_A 375 Ternary Complex Of A Calcineurin A Fragment, Calcin 4e-33
2jog_A327 Structure Of The Calcineurin-Nfat Complex Length = 5e-33
1s95_A333 Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 2e-24
1wao_1477 Pp5 Structure Length = 477 2e-24
3h60_A315 Catalytic Domain Of Human SerineTHREONINE PHOSPHATA 3e-24
3icf_A335 Structure Of Protein SerineTHREONINE PHOSPHATASE FR 4e-22
>pdb|2NYL|C Chain C, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 293 Back     alignment and structure

Iteration: 1

Score = 266 bits (681), Expect = 6e-72, Method: Compositional matrix adjust. Identities = 126/157 (80%), Positives = 137/157 (87%) Query: 16 EQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFQI 75 + I QL +CK LSE QVK+LCEKAKEIL +ESNVQ V+ PVT+CGD+HGQFHDL ELF+I Sbjct: 11 QWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRI 70 Query: 76 GGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYD 135 GGK PDTNYLFMGDYVDRGYYSVETVTLLVALKVRY +RITILRGNHESRQITQVYGFYD Sbjct: 71 GGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYD 130 Query: 136 ECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVG 172 ECLRKYGNAN+WK FTDLFDY PLTAL C+ G Sbjct: 131 ECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHG 167
>pdb|3P71|C Chain C, Crystal Structure Of The Complex Of Lcmt-1 And Pp2a Length = 304 Back     alignment and structure
>pdb|2IE3|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 309 Back     alignment and structure
>pdb|3C5W|C Chain C, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 310 Back     alignment and structure
>pdb|2IE4|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Okadaic Acid Length = 309 Back     alignment and structure
>pdb|2IAE|C Chain C, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 309 Back     alignment and structure
>pdb|3FGA|C Chain C, Structural Basis Of Pp2a And Sgo Interaction Length = 309 Back     alignment and structure
>pdb|3E7A|A Chain A, Crystal Structure Of Protein Phosphatase-1 Bound To The Natural Toxin Nodularin-R Length = 299 Back     alignment and structure
>pdb|3V4Y|A Chain A, Crystal Structure Of The First Nuclear Pp1 Holoenzyme Length = 306 Back     alignment and structure
>pdb|1U32|A Chain A, Crystal Structure Of A Protein Phosphatase-1: Calcineurin Hybrid Bound To Okadaic Acid Length = 293 Back     alignment and structure
>pdb|4G9J|A Chain A, Protein SerTHR PHOSPHATASE-1 In Complex With Cell-Permeable Peptide Length = 331 Back     alignment and structure
>pdb|1FJM|A Chain A, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin Length = 330 Back     alignment and structure
>pdb|3EGG|A Chain A, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 329 Back     alignment and structure
>pdb|2O8A|A Chain A, Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Length = 329 Back     alignment and structure
>pdb|1JK7|A Chain A, Crystal Structure Of The Tumor-Promoter Okadaic Acid Bound To Protein Phosphatase-1 Length = 323 Back     alignment and structure
>pdb|1S70|A Chain A, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 330 Back     alignment and structure
>pdb|1AUI|A Chain A, Human Calcineurin Heterodimer Length = 521 Back     alignment and structure
>pdb|3LL8|A Chain A, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 357 Back     alignment and structure
>pdb|1M63|A Chain A, Crystal Structure Of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition Of Immunophilin-Drug Complexes Length = 372 Back     alignment and structure
>pdb|1MF8|A Chain A, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 373 Back     alignment and structure
>pdb|2P6B|A Chain A, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 383 Back     alignment and structure
>pdb|1TCO|A Chain A, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 375 Back     alignment and structure
>pdb|2JOG|A Chain A, Structure Of The Calcineurin-Nfat Complex Length = 327 Back     alignment and structure
>pdb|1S95|A Chain A, Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 Length = 333 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|3H60|A Chain A, Catalytic Domain Of Human SerineTHREONINE PHOSPHATASE 5 (Pp5c)with Two Mn2+ Atoms Length = 315 Back     alignment and structure
>pdb|3ICF|A Chain A, Structure Of Protein SerineTHREONINE PHOSPHATASE FROM SACCHAROMYCES Cerevisiae With Similarity To Human Phosphatase Pp5 Length = 335 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 1e-111
3ll8_A 357 Serine/threonine-protein phosphatase 2B catalytic 1e-106
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 1e-104
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 1e-103
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 1e-101
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 1e-100
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 1e-98
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 1e-97
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 8e-16
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 4e-11
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 2e-09
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 2e-08
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 1e-06
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 1e-05
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 6e-05
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 Back     alignment and structure
 Score =  320 bits (823), Expect = e-111
 Identities = 127/153 (83%), Positives = 138/153 (90%)

Query: 10  TTTDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDL 69
            T +LD+ I QL +CK LSE QVK+LCEKAKEIL +ESNVQ V+ PVT+CGD+HGQFHDL
Sbjct: 6   FTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDL 65

Query: 70  AELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQ 129
            ELF+IGGK PDTNYLFMGDYVDRGYYSVETVTLLVALKVRY +RITILRGNHESRQITQ
Sbjct: 66  MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQ 125

Query: 130 VYGFYDECLRKYGNANIWKIFTDLFDYFPLTAL 162
           VYGFYDECLRKYGNAN+WK FTDLFDY PLTAL
Sbjct: 126 VYGFYDECLRKYGNANVWKYFTDLFDYLPLTAL 158


>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Length = 342 Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Length = 221 Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Length = 280 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Length = 262 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Length = 252 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Length = 270 Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} Length = 246 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 100.0
3ll8_A 357 Serine/threonine-protein phosphatase 2B catalytic 100.0
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 100.0
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 100.0
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 100.0
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 100.0
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 100.0
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 100.0
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 99.96
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 99.95
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 99.95
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 99.9
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 99.83
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 99.82
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 99.8
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 99.53
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 99.46
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 99.44
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 99.41
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 99.29
3ck2_A176 Conserved uncharacterized protein (predicted phosp 99.29
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 99.26
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 99.26
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 99.21
3ib7_A 330 ICC protein; metallophosphoesterase, alpha-beta fo 99.06
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 99.01
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 98.86
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 98.85
2q8u_A 336 Exonuclease, putative; structural genomics, joint 98.55
1ii7_A 333 MRE11 nuclease; RAD50, DNA double-strand break rep 98.49
2nxf_A 322 Putative dimetal phosphatase; dinuclear metal cent 98.45
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 98.27
3tho_B 379 Exonuclease, putative; adenosine triphosphate, bac 98.17
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 98.04
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 98.03
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 98.01
1ute_A 313 Protein (II purple acid phosphatase); tartrate res 97.72
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 97.57
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 97.31
3tgh_A 342 Glideosome-associated protein 50; phosphatase fold 96.72
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 96.72
3qfk_A 527 Uncharacterized protein; structural genomics, cent 96.56
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 96.32
1t71_A281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 96.3
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 96.11
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 96.01
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 95.9
3gve_A 341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 95.26
1t70_A255 Phosphatase; crystal, X-RAY crystallography, struc 95.19
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 95.04
3jyf_A 339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 95.0
2z06_A252 Putative uncharacterized protein TTHA0625; metal b 94.8
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 93.5
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 90.03
2yeq_A 527 Apased, PHOD, alkaline phosphatase D; hydrolase, p 85.91
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
Probab=100.00  E-value=4.9e-40  Score=286.42  Aligned_cols=166  Identities=45%  Similarity=0.905  Sum_probs=156.9

Q ss_pred             ccCHHHHHHHHhcCC--------CCCHHHHHHHHHHHHHHHhhcCCccccCCceeEecCCCccHHHHHHHHHhcCCCCCc
Q 026605           11 TTDLDEQISQLMQCK--------PLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFQIGGKCPDT   82 (236)
Q Consensus        11 ~~~~~~~~~~~~~~~--------~~~~~~~~~l~~~~~~~~~~e~~~~~~~~~i~vigDIHG~~~~L~~ll~~~~~~~~~   82 (236)
                      ..++|++|+++++..        +++++++..||++|+++|++||+++++.+|++||||||||+.+|.++|+.++.++.+
T Consensus         5 ~~~~d~~i~~l~~~~~~~~~~~~~l~~~~~~~l~~~~~~il~~ep~ll~~~~~i~viGDIHG~~~~L~~ll~~~g~~~~~   84 (299)
T 3e7a_A            5 SLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPES   84 (299)
T ss_dssp             -CCHHHHHHHHHTTTTSCTTCCCCCCHHHHHHHHHHHHHHHHHSCSEEEECSSEEEECBCTTCHHHHHHHHHHHCSTTSS
T ss_pred             ccCHHHHHHHHHhccccCCCcccCCCHHHHHHHHHHHHHHHHhCCCeeecCCCEEEEecCCCCHHHHHHHHHHhCCCCCc
Confidence            346999999997654        689999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEeccccCCCCCCHHHHHHHHHhhhhCCCCeEEEccCccccccccccCcHHHHHHHhCCchhHHHHHHHhccCcceEE
Q 026605           83 NYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTAL  162 (236)
Q Consensus        83 ~~v~LGD~vdrG~~s~e~l~~l~~lk~~~p~~v~~lrGNHE~~~~~~~~~f~~e~~~~~~~~~l~~~~~~~~~~LP~~~~  162 (236)
                      .+||||||||||++|.|++.+|+++|..+|+++++||||||.+.++..++|.+++.++| ...+|+.+.+||++||++++
T Consensus        85 ~~vfLGD~VDrG~~s~evl~lL~~lk~~~p~~v~~lrGNHE~~~i~~~ygF~~e~~~ky-~~~l~~~~~~~f~~LPlaai  163 (299)
T 3e7a_A           85 NYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRY-NIKLWKTFTDCFNCLPIAAI  163 (299)
T ss_dssp             CEEECSCCSSSSSCHHHHHHHHHHHHHHSTTTEEECCCTTSSHHHHHHHSHHHHHHHHS-CHHHHHHHHHHHTTCCCEEE
T ss_pred             cEEeCCcccCCCCCcHHHHHHHHHHHhhCCCcEEEEecCchhhhhcccccchHHHHHHh-hHHHHHHHHHHHhhCCceEE
Confidence            99999999999999999999999999999999999999999999999999999999999 57899999999999999999


Q ss_pred             ECcEEEEEeCCCccc
Q 026605          163 SQKYSVCMVGCPLQL  177 (236)
Q Consensus       163 ~~~~~~~~hg~~~~~  177 (236)
                      ++++++|+||++++.
T Consensus       164 i~~~il~vHGGlsp~  178 (299)
T 3e7a_A          164 VDEKIFCCHGGLSPD  178 (299)
T ss_dssp             ETTTEEEESSCCCTT
T ss_pred             ECCeEEEEcCccCcc
Confidence            998999999987654



>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure
>2yeq_A Apased, PHOD, alkaline phosphatase D; hydrolase, phosphodiesterase; HET: PE5; 1.93A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 236
d3c5wc1288 d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt 3e-69
d1auia_ 473 d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc 1e-64
d1jk7a_294 d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human 1e-57
d1s95a_324 d.159.1.3 (A:) Serine/threonine protein phosphatas 1e-56
d1g5ba_219 d.159.1.3 (A:) lambda ser/thr protein phosphatase 5e-13
d1nnwa_251 d.159.1.5 (A:) Hypothetical protein PF1291 {Archae 4e-12
d1su1a_184 d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia 2e-07
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  212 bits (540), Expect = 3e-69
 Identities = 129/164 (78%), Positives = 141/164 (85%)

Query: 11  TTDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLA 70
           T +LD+ I QL +CK LSE QVK+LCEKAKEIL +ESNVQ V+ PVT+CGD+HGQFHDL 
Sbjct: 2   TKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLM 61

Query: 71  ELFQIGGKCPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQV 130
           ELF+IGGK PDTNYLFMGDYVDRGYYSVETVTLLVALKVRY +RITILRGNHESRQITQV
Sbjct: 62  ELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQV 121

Query: 131 YGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMVGCP 174
           YGFYDECLRKYGNAN+WK FTDLFDY PLTAL      C+ G  
Sbjct: 122 YGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGL 165


>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Length = 219 Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 251 Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 100.0
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 100.0
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 100.0
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 100.0
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 99.94
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 99.86
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.72
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 99.58
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 99.56
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 99.38
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 99.36
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 99.29
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 99.16
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 98.58
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 98.53
d1ii7a_ 333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.49
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 98.35
d2nxfa1 320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 98.01
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 97.21
d2qfra2 312 Plant purple acid phosphatase, catalytic domain {K 97.21
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 94.99
d1usha2 337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 92.94
d3c9fa2 322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 88.97
d1gg4a1135 UDP-murNac-tripeptide D-alanyl-D-alanine-adding en 83.17
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.3e-43  Score=305.61  Aligned_cols=166  Identities=77%  Similarity=1.245  Sum_probs=161.2

Q ss_pred             cCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhcCCccccCCceeEecCCCccHHHHHHHHHhcCCCCCceEEEecccc
Q 026605           12 TDLDEQISQLMQCKPLSEPQVKALCEKAKEILMEESNVQPVKSPVTICGDIHGQFHDLAELFQIGGKCPDTNYLFMGDYV   91 (236)
Q Consensus        12 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~e~~~~~~~~~i~vigDIHG~~~~L~~ll~~~~~~~~~~~v~LGD~v   91 (236)
                      .++|++|+++++++.++++++.+||++|+++|++||+++++..|++|||||||++++|.++|+..+.++..+++||||||
T Consensus         3 ~~~d~~i~~~~~~~~l~~~~i~~L~~~a~~il~~e~~l~~i~~pv~VvGDlHG~~~DL~~if~~~g~p~~~~ylFLGDYV   82 (288)
T d3c5wc1           3 KELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYV   82 (288)
T ss_dssp             HHHHHHHHHHTTTCCCCHHHHHHHHHHHHHHHHTSCSEEEECSSEEEECBCTTCHHHHHHHHHHHCCTTTSCEEECSCCC
T ss_pred             hHHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHhCCCEEEeCCCeEEEeeCCCCHHHHHHHHHhcCCCccceEEecCccc
Confidence            46899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCHHHHHHHHHhhhhCCCCeEEEccCccccccccccCcHHHHHHHhCCchhHHHHHHHhccCcceEEECcEEEEEe
Q 026605           92 DRGYYSVETVTLLVALKVRYPQRITILRGNHESRQITQVYGFYDECLRKYGNANIWKIFTDLFDYFPLTALSQKYSVCMV  171 (236)
Q Consensus        92 drG~~s~e~l~~l~~lk~~~p~~v~~lrGNHE~~~~~~~~~f~~e~~~~~~~~~l~~~~~~~~~~LP~~~~~~~~~~~~h  171 (236)
                      |||++|+||+.+|.++|..+|++++++|||||...++..+||..|+..+|+...+|+.+.++|++||+++++++++||+|
T Consensus        83 DRG~~slEvl~lL~alKi~~P~~v~lLRGNHE~~~~~~~~gF~~E~~~ky~~~~i~~~~~~~F~~LPlaaiI~~~i~cvH  162 (288)
T d3c5wc1          83 DRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLH  162 (288)
T ss_dssp             CSSSSHHHHHHHHHHHHHHCTTTEEECCCTTSSHHHHHHHSHHHHHHHHHSSSHHHHHHHHHHTTSCSEEEETTTEEEES
T ss_pred             CCCCcceeHHHHHHHHHhhCCCeEEEeccCCcccccccccCcchhhhhhcCcHHHHHHHHHHHhhccceEEecCeEEEec
Confidence            99999999999999999999999999999999999999999999999999988999999999999999999999999999


Q ss_pred             CCCccc
Q 026605          172 GCPLQL  177 (236)
Q Consensus       172 g~~~~~  177 (236)
                      |++++.
T Consensus       163 GGi~~~  168 (288)
T d3c5wc1         163 GGLSPS  168 (288)
T ss_dssp             SCCCTT
T ss_pred             ccccCC
Confidence            997653



>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure
>d1gg4a1 c.59.1.1 (A:313-447) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure