Citrus Sinensis ID: 026609

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------

MVTMDQETAGELDYVFLCVLPLFHVFGLAVITCGQLQKGSCIILMAKFDLEMFLRAIEKHRVTHIWVVPPLILALAKHGLVKKFDLSSLKLVGSGAAPLGKELMEECAKNVPSATVIQVGYGLTETSGIATMENSFAGSRNIGSAGALAPGVEALIVSVDTQKPLPPNQLGEIWLRGPNMMRGYYNNEQATKLTIDKKGWVHTGDLGYFDGDGQLYVVDRIKELIKYKGFQVTSNW

cccccccccccccEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHcccEEcccHHHHHHHHHccccccccccccccEECccccccHHHHHHHHHHcccccEEEEcccccccccccccccccccccccccccccccccEEEEEEccccccccccccEEEEEEcccccccccccHHHHHHccccccccccccEEEECccccEEEEcccHHHHHcccccccccc

*********GELDYVFLCVLPLFHVFGLAVITCGQLQKGSCIILMAKFDLEMFLRAIEKHRVTHIWVVPPLILALAKHGLVKKFDLSSLKLVGSGAAPLGKELMEECAKNVPSATVIQVGYGLTETSGIATMENSFAGSRNIGSAGALAPGVEALIVSVDTQKPLPPNQLGEIWLRGPNMMRGYYNNEQATKLTIDKKGWVHTGDLGYFDGDGQLYVVDRIKELIKYKGFQVTSN*

xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
4-coumarate--CoA ligase-like 7	Contributes to jasmonic acid biosynthesis by initiating the beta-oxidative chain shortening of its precursors.	probable	Q9M0X9

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TSY, chain A
Confidence level:very confident
Coverage over the Query: 7-223
View the alignment between query and template
View the model in PyMOL