Citrus Sinensis ID: 026625


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MAEDKKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFLV
cccccccccccccccccccEEcccccccccccccccccccHHHHHHHHHHHHHcccccECccccccccccHHHHHHHHcccccccEEEEEEccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHccccccHHHHHHHHccccccHHHHHHHHHcccEEEEccccccccccccccccccccccccc
************KLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPL*SFLV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEDKKLQVPRVKLGTQGLEVSKLGYGCMSLSGCYNSPLSEEDGISIIKHAFSKGITFFDTADKYGPYTNEILLGKALKELPRENIQVATKFGFVELGFTSVIVKGTPEYVRSCCEASLRRLDVEYIDLYYQHRVDTSVPIEETIGEMKKLVEEGKIKYIGLSEASPDTIRRAHAVHPITAVQLEWSLWARDIENEIVPLCRELGIGIVPYCPLGRGFFGGKAVVESVPLDSFLV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Perakine reductase Aldo-keto reductase involved in the biosynthesis of monoterpenoid indole alkaloids. Broad substrate specificity enzyme with a high selectivity in the group of alkaloids. Can use perakine, 19(S),20(R)-dihydro-peraksine-17,21-al, cinnamic aldehyde, p-coumaric aldehyde and 3-(3,4,5-trimethoxyphenyl)propanal as substrates, but not ketosteroids such as progesterone. NADPH could not be replaced by NADH.probableQ3L181
Probable aldo-keto reductase 2 probableQ84M96

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V0S, chain A
Confidence level:very confident
Coverage over the Query: 9-222
View the alignment between query and template
View the model in PyMOL