Citrus Sinensis ID: 026690

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----

MEFYAYPSRFSMSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL

cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccccccccccccccccHHHHHccccEEEEccccccccccccccccHHcccccccCEccccccccccccccHHHHHccccccccccccc

***YAYPSRFSMSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NEP1-interacting protein 1	Intrinsic thylakoid membrane protein that fixes RPOT2 on the stromal side of the thylakoid membrane.	confident	Q8GT75
NEP1-interacting protein-like 1	May be involved in the early steps of the plant defense signaling pathway.	probable	Q9FKX5
NEP1-interacting protein 2	Intrinsic thylakoid membrane protein that fixes RPOT2 on the stromal side of the thylakoid membrane.	probable	Q8GT74

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:very confident
Coverage over the Query: 153-235
View the alignment between query and template
View the model in PyMOL