Citrus Sinensis ID: 026690


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MEFYAYPSRFSMSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccccccccccccccccHHHHHccccEEEEccccccccccccccccHHcccccccCEccccccccccccccHHHHHccccccccccccc
***YAYPSRFSMSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFYAYPSRFSMSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NEP1-interacting protein 1 Intrinsic thylakoid membrane protein that fixes RPOT2 on the stromal side of the thylakoid membrane.confidentQ8GT75
NEP1-interacting protein-like 1 May be involved in the early steps of the plant defense signaling pathway.probableQ9FKX5
NEP1-interacting protein 2 Intrinsic thylakoid membrane protein that fixes RPOT2 on the stromal side of the thylakoid membrane.probableQ8GT74

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:very confident
Coverage over the Query: 153-235
View the alignment between query and template
View the model in PyMOL