Citrus Sinensis ID: 026690


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MEFYAYPSRFSMSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL
ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccccccccccccccccHHHHHccccEEEEccccccccccccccccHHcccccccEEccccccccccccccHHHHHccccccccccccc
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccHHHHcccHHHHHHHHHHHccHHcHHHHHHHHHcccccccccHHHHHHccEEEEEEEccccccccccccEEEHHHccccccEEccccccccccHHHHHHHHHcccccccccccc
mefyaypsrfsmsslSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGaligqetesgfvrGAAVGAISGAVFSIEVFESSLVLwqsdesgiGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAvevsfdeapnifdtglskgltgesvdkipkititdknnidasgervscsvclqdfqlgetarslphchhmfhipcidkwllghascplcrrdl
mefyaypsrfsmsSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTglskgltgesvdkipkititdknnidasGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL
MEFYAYPSRFSMSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL
***YAYPSRFSMSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLC****
*********F***SLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGA*******************L*GESVDKIPKITITDKNN***SGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL
MEFYAYPSRFSMSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL
**FYAYPSRFSMSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLC****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFYAYPSRFSMSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query235 2.2.26 [Sep-21-2011]
Q8GT75236 NEP1-interacting protein yes no 0.919 0.915 0.800 2e-99
Q8GT74241 NEP1-interacting protein no no 0.923 0.900 0.792 1e-98
Q9FKX5221 NEP1-interacting protein- no no 0.923 0.981 0.765 1e-95
Q8LBA0223 NEP1-interacting protein- no no 0.885 0.932 0.364 1e-33
Q9SRQ8 356 RING-H2 finger protein AT no no 0.268 0.176 0.507 4e-14
Q8L9T5 304 RING-H2 finger protein AT no no 0.297 0.230 0.418 5e-14
Q9LS99220 RING-H2 finger protein AT no no 0.336 0.359 0.407 3e-13
Q9FLC6176 RING-H2 finger protein AT no no 0.357 0.477 0.397 4e-13
Q94BY6226 RING-H2 finger protein AT no no 0.319 0.331 0.428 4e-13
O22755185 RING-H2 finger protein AT no no 0.327 0.416 0.419 5e-13
>sp|Q8GT75|NIP1_ARATH NEP1-interacting protein 1 OS=Arabidopsis thaliana GN=NIP1 PE=1 SV=2 Back     alignment and function desciption
 Score =  362 bits (928), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 173/216 (80%), Positives = 192/216 (88%)

Query: 20  NFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESGFVRGAAVG 79
           NF ER+K+ C F +SAV+G I SA+ TFFFALVGTLLGA+TGALIGQETESGF+RGAAVG
Sbjct: 21  NFIERIKDACRFTLSAVLGTILSAVLTFFFALVGTLLGALTGALIGQETESGFIRGAAVG 80

Query: 80  AISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPAMLSAVQSQ 139
           AISGAVFSIEVFESSLVLW+S+ES  GCLLYLIDVI SL+SGRLVRERIGPAMLSAVQSQ
Sbjct: 81  AISGAVFSIEVFESSLVLWKSNESRFGCLLYLIDVIVSLISGRLVRERIGPAMLSAVQSQ 140

Query: 140 MGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQL 199
           MGAV+ +F+E  +IFDTG SKGLTG+ VDKIPKI IT KNN+DASG + SCSVCLQDFQL
Sbjct: 141 MGAVDSTFEELSSIFDTGGSKGLTGDLVDKIPKIKITGKNNLDASGNKDSCSVCLQDFQL 200

Query: 200 GETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL 235
           GET RSLPHCHHMFH+PCID WL  H SCP+CRRDL
Sbjct: 201 GETVRSLPHCHHMFHLPCIDNWLFRHGSCPMCRRDL 236




Intrinsic thylakoid membrane protein that fixes RPOT2 on the stromal side of the thylakoid membrane.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8GT74|NIP2_ARATH NEP1-interacting protein 2 OS=Arabidopsis thaliana GN=NIP2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FKX5|NIPL1_ARATH NEP1-interacting protein-like 1 OS=Arabidopsis thaliana GN=ATL27 PE=2 SV=1 Back     alignment and function description
>sp|Q8LBA0|NIPL2_ARATH NEP1-interacting protein-like 2 OS=Arabidopsis thaliana GN=ATL24 PE=1 SV=2 Back     alignment and function description
>sp|Q9SRQ8|ATL51_ARATH RING-H2 finger protein ATL51 OS=Arabidopsis thaliana GN=ATL51 PE=2 SV=2 Back     alignment and function description
>sp|Q8L9T5|ATL2_ARATH RING-H2 finger protein ATL2 OS=Arabidopsis thaliana GN=ATL2 PE=2 SV=2 Back     alignment and function description
>sp|Q9LS99|ATL77_ARATH RING-H2 finger protein ATL77 OS=Arabidopsis thaliana GN=ATL77 PE=2 SV=1 Back     alignment and function description
>sp|Q9FLC6|ATL73_ARATH RING-H2 finger protein ATL73 OS=Arabidopsis thaliana GN=ATL73 PE=2 SV=1 Back     alignment and function description
>sp|Q94BY6|ATL75_ARATH RING-H2 finger protein ATL75 OS=Arabidopsis thaliana GN=ATL75 PE=2 SV=1 Back     alignment and function description
>sp|O22755|ATL44_ARATH RING-H2 finger protein ATL44 OS=Arabidopsis thaliana GN=ATL44 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
255579580235 RING-H2 finger protein ATL4M, putative [ 1.0 1.0 0.876 1e-117
225468578235 PREDICTED: NEP1-interacting protein 1 [V 0.995 0.995 0.847 1e-111
224133604224 predicted protein [Populus trichocarpa] 0.953 1.0 0.875 1e-109
224117248224 predicted protein [Populus trichocarpa] 0.948 0.995 0.865 1e-108
449456847235 PREDICTED: NEP1-interacting protein 1-li 1.0 1.0 0.821 1e-105
301070456241 plastid NEP interaction protein [Nicotia 1.0 0.975 0.767 1e-102
388495990237 unknown [Lotus japonicus] 1.0 0.991 0.789 1e-102
157887047235 NEP1-interacting protein [Spinacia olera 1.0 1.0 0.778 1e-102
351727597242 uncharacterized protein LOC100306109 [Gl 0.978 0.950 0.798 1e-101
356496604256 PREDICTED: LOW QUALITY PROTEIN: NEP1-int 0.978 0.898 0.789 1e-100
>gi|255579580|ref|XP_002530631.1| RING-H2 finger protein ATL4M, putative [Ricinus communis] gi|223529804|gb|EEF31739.1| RING-H2 finger protein ATL4M, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/235 (87%), Positives = 219/235 (93%)

Query: 1   MEFYAYPSRFSMSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMT 60
           MEFY YPSRFSMSSL   G+F E++KE CNFAVSAVIGNIFSAIFTFFFALVGTLLGAMT
Sbjct: 1   MEFYPYPSRFSMSSLPFFGDFVEKIKEVCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMT 60

Query: 61  GALIGQETESGFVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLS 120
           GALIGQETESGFVRGAAVGAISGAVFSIEVFESSL+LWQSDESGIGCLLYLIDVIASLLS
Sbjct: 61  GALIGQETESGFVRGAAVGAISGAVFSIEVFESSLLLWQSDESGIGCLLYLIDVIASLLS 120

Query: 121 GRLVRERIGPAMLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNN 180
           GRLVRERIGPAMLSAVQSQMGAVE SF+E  NIFDTG +KGLTG++V+KIPKI IT  N 
Sbjct: 121 GRLVRERIGPAMLSAVQSQMGAVETSFEEVQNIFDTGGAKGLTGDTVEKIPKIKITSNNT 180

Query: 181 IDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL 235
           IDASGE+V+CSVCLQDFQ+GET RSLPHCHHMFH+PCIDKWLL HASCPLCRRDL
Sbjct: 181 IDASGEKVACSVCLQDFQVGETVRSLPHCHHMFHLPCIDKWLLRHASCPLCRRDL 235




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225468578|ref|XP_002263471.1| PREDICTED: NEP1-interacting protein 1 [Vitis vinifera] gi|296084057|emb|CBI24445.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224133604|ref|XP_002327636.1| predicted protein [Populus trichocarpa] gi|222836721|gb|EEE75114.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224117248|ref|XP_002331758.1| predicted protein [Populus trichocarpa] gi|222874455|gb|EEF11586.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449456847|ref|XP_004146160.1| PREDICTED: NEP1-interacting protein 1-like [Cucumis sativus] gi|449533956|ref|XP_004173936.1| PREDICTED: NEP1-interacting protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|301070456|gb|ADK55590.1| plastid NEP interaction protein [Nicotiana benthamiana] Back     alignment and taxonomy information
>gi|388495990|gb|AFK36061.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|157887047|emb|CAP03014.1| NEP1-interacting protein [Spinacia oleracea] Back     alignment and taxonomy information
>gi|351727597|ref|NP_001237678.1| uncharacterized protein LOC100306109 [Glycine max] gi|255627575|gb|ACU14132.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356496604|ref|XP_003517156.1| PREDICTED: LOW QUALITY PROTEIN: NEP1-interacting protein 1-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query235
TAIR|locus:2125364236 AT4G35840 [Arabidopsis thalian 0.953 0.949 0.781 3e-92
TAIR|locus:2156867245 AT5G66070 [Arabidopsis thalian 0.574 0.551 0.776 3.6e-50
TAIR|locus:2019110223 AT1G74410 [Arabidopsis thalian 0.885 0.932 0.364 1.5e-37
TAIR|locus:4010713762223 AT3G20395 [Arabidopsis thalian 0.817 0.860 0.315 5.2e-26
TAIR|locus:2830088220 AT3G18773 [Arabidopsis thalian 0.370 0.395 0.384 5.4e-15
TAIR|locus:2096444 356 AT3G03550 [Arabidopsis thalian 0.293 0.193 0.478 7.3e-15
TAIR|locus:2089398 304 ATL2 "TOXICOS EN LEVADURA 2" [ 0.370 0.286 0.387 9.8e-15
TAIR|locus:2028411226 AT1G49200 [Arabidopsis thalian 0.319 0.331 0.428 1.1e-14
TAIR|locus:2053863185 RHA3A "RING-H2 finger A3A" [Ar 0.327 0.416 0.419 1.4e-14
TAIR|locus:2153554176 DAF "DEFECTIVE IN ANTHER DEHIS 0.357 0.477 0.397 3e-14
TAIR|locus:2125364 AT4G35840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 919 (328.6 bits), Expect = 3.0e-92, P = 3.0e-92
 Identities = 175/224 (78%), Positives = 195/224 (87%)

Query:    12 MSSLSLCGNFFERVKEFCNFAVSAVIGNIFSAIFTFFFALVGTLLGAMTGALIGQETESG 71
             +SS     NF ER+K+ C F +SAV+G I SA+ TFFFALVGTLLGA+TGALIGQETESG
Sbjct:    13 ISSCPSLENFIERIKDACRFTLSAVLGTILSAVLTFFFALVGTLLGALTGALIGQETESG 72

Query:    72 FVRGAAVGAISGAVFSIEVFESSLVLWQSDESGIGCLLYLIDVIASLLSGRLVRERIGPA 131
             F+RGAAVGAISGAVFSIEVFESSLVLW+S+ES  GCLLYLIDVI SL+SGRLVRERIGPA
Sbjct:    73 FIRGAAVGAISGAVFSIEVFESSLVLWKSNESRFGCLLYLIDVIVSLISGRLVRERIGPA 132

Query:   132 MLSAVQSQMGAVEVSFDEAPNIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCS 191
             MLSAVQSQMGAV+ +F+E  +IFDTG SKGLTG+ VDKIPKI IT KNN+DASG + SCS
Sbjct:   133 MLSAVQSQMGAVDSTFEELSSIFDTGGSKGLTGDLVDKIPKIKITGKNNLDASGNKDSCS 192

Query:   192 VCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL 235
             VCLQDFQLGET RSLPHCHHMFH+PCID WL  H SCP+CRRDL
Sbjct:   193 VCLQDFQLGETVRSLPHCHHMFHLPCIDNWLFRHGSCPMCRRDL 236




GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2156867 AT5G66070 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019110 AT1G74410 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713762 AT3G20395 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2830088 AT3G18773 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096444 AT3G03550 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089398 ATL2 "TOXICOS EN LEVADURA 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028411 AT1G49200 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053863 RHA3A "RING-H2 finger A3A" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153554 DAF "DEFECTIVE IN ANTHER DEHISCENCE1- ( DAD1-) Activating Factor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FKX5NIPL1_ARATHNo assigned EC number0.76540.92340.9819nono
Q8GT75NIP1_ARATHNo assigned EC number0.80090.91910.9152yesno
Q8GT74NIP2_ARATHNo assigned EC number0.79260.92340.9004nono

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00013721001
SubName- Full=Chromosome undetermined scaffold_533, whole genome shotgun sequence; (235 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 1e-15
cd0016245 cd00162, RING, RING-finger (Really Interesting New 3e-12
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 8e-11
smart0018440 smart00184, RING, Ring finger 8e-08
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 5e-07
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 2e-06
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 3e-06
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 2e-05
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 1e-04
pfam13436116 pfam13436, Gly-zipper_OmpA, Glycine-zipper contain 2e-04
pfam1344145 pfam13441, Gly-zipper_YMGG, YMGG-like Gly-zipper 2e-04
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 4e-04
pfam1348846 pfam13488, Gly-zipper_Omp, Glycine zipper 6e-04
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 7e-04
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 0.003
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 67.8 bits (166), Expect = 1e-15
 Identities = 22/46 (47%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 189 SCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRD 234
            C +CL +F+ GE    LP C H+FH  C+DKWL    +CPLCR  
Sbjct: 2   ECPICLDEFEPGEEVVVLP-CGHVFHKECLDKWLRSSNTCPLCRAP 46


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222127 pfam13436, Gly-zipper_OmpA, Glycine-zipper containing OmpA-like membrane domain Back     alignment and domain information
>gnl|CDD|222132 pfam13441, Gly-zipper_YMGG, YMGG-like Gly-zipper Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>gnl|CDD|205666 pfam13488, Gly-zipper_Omp, Glycine zipper Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 235
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.7
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.64
PHA02929238 N1R/p28-like protein; Provisional 99.47
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.41
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.35
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.34
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.19
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.19
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.17
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.15
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.09
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.07
PHA02926242 zinc finger-like protein; Provisional 99.05
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.98
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.98
PF1463444 zf-RING_5: zinc-RING finger domain 98.94
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.9
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.89
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.89
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.89
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.85
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.81
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.79
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.73
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.62
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.59
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.52
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.45
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.44
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.43
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.42
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.4
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.35
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.34
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.26
COG52191525 Uncharacterized conserved protein, contains RING Z 98.22
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.21
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 98.0
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.97
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.89
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.82
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.81
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.79
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.62
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.6
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.45
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 97.37
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.31
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.25
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 97.23
KOG1941 518 consensus Acetylcholine receptor-associated protei 97.23
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 97.06
PHA02825 162 LAP/PHD finger-like protein; Provisional 96.98
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.9
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 96.89
PHA03096284 p28-like protein; Provisional 96.83
PF13436118 Gly-zipper_OmpA: Glycine-zipper containing OmpA-li 96.8
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.76
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 96.75
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.71
KOG2660 331 consensus Locus-specific chromosome binding protei 96.63
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 96.61
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.56
PF1344145 Gly-zipper_YMGG: YMGG-like Gly-zipper 96.41
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.33
PF1348846 Gly-zipper_Omp: Glycine zipper 96.32
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.31
COG5152259 Uncharacterized conserved protein, contains RING a 96.23
KOG1002 791 consensus Nucleotide excision repair protein RAD16 96.21
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.12
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 96.12
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.03
PF0543342 Rick_17kDa_Anti: Glycine zipper 2TM domain; InterP 95.88
PF13436118 Gly-zipper_OmpA: Glycine-zipper containing OmpA-li 95.82
PF1344145 Gly-zipper_YMGG: YMGG-like Gly-zipper 95.77
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 95.74
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.71
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 95.64
PF1348846 Gly-zipper_Omp: Glycine zipper 95.56
COG5222 427 Uncharacterized conserved protein, contains RING Z 95.27
PRK10510219 putative outer membrane lipoprotein; Provisional 95.14
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 95.1
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.05
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 94.82
KOG1609 323 consensus Protein involved in mRNA turnover and st 94.61
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 94.57
KOG1940276 consensus Zn-finger protein [General function pred 94.53
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 94.5
PF04641260 Rtf2: Rtf2 RING-finger 94.16
PF10272358 Tmpp129: Putative transmembrane protein precursor; 93.92
KOG3053 293 consensus Uncharacterized conserved protein [Funct 93.27
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 93.17
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 92.87
PRK10510219 putative outer membrane lipoprotein; Provisional 92.86
PRK11280170 hypothetical protein; Provisional 92.78
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 92.54
COG5175 480 MOT2 Transcriptional repressor [Transcription] 92.45
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 92.41
PRK1054072 lipoprotein; Provisional 92.03
TIGR03789239 pdsO proteobacterial sortase system OmpA family pr 91.91
KOG3002 299 consensus Zn finger protein [General function pred 91.8
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 90.91
PF06897102 DUF1269: Protein of unknown function (DUF1269); In 90.86
PF06897102 DUF1269: Protein of unknown function (DUF1269); In 90.35
KOG0825 1134 consensus PHD Zn-finger protein [General function 90.24
PLN02720140 complex II 90.13
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 89.99
KOG0298 1394 consensus DEAD box-containing helicase-like transc 89.77
KOG3005276 consensus GIY-YIG type nuclease [General function 88.85
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 88.71
PF0543342 Rick_17kDa_Anti: Glycine zipper 2TM domain; InterP 88.16
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 88.13
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 87.65
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 86.82
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 86.69
KOG3899381 consensus Uncharacterized conserved protein [Funct 86.58
COG4803170 Predicted membrane protein [Function unknown] 85.59
KOG1829580 consensus Uncharacterized conserved protein, conta 85.16
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 84.99
KOG03091081 consensus Conserved WD40 repeat-containing protein 84.82
PF05818215 TraT: Enterobacterial TraT complement resistance p 84.8
PF13901202 DUF4206: Domain of unknown function (DUF4206) 84.7
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 84.52
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 83.48
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 83.44
PF1371937 zinc_ribbon_5: zinc-ribbon domain 82.34
COG4803170 Predicted membrane protein [Function unknown] 81.9
PRK11677134 hypothetical protein; Provisional 81.3
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.70  E-value=5.6e-18  Score=154.13  Aligned_cols=73  Identities=40%  Similarity=0.939  Sum_probs=63.4

Q ss_pred             CCCCCHHHHhcCCceeeccCCCcCCCCCCccCccccccccCCCceeecCCCCCcccHhhHHHHHhcCCC-CCCccCCC
Q 026690          159 SKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHAS-CPLCRRDL  235 (235)
Q Consensus       159 ~~gls~~~i~~lp~~~~~~~~~~~~~~e~~~C~ICle~f~~ge~v~~Lp~C~H~FH~~CI~~WL~~~~s-CPlCR~~v  235 (235)
                      .+.+.++.++++|..+++...+.+..   ..|+||+|+|++||++|.|| |+|.||..||++||.++.+ ||+||+++
T Consensus       204 ~~r~~k~~l~~~p~~~f~~~~~~~~~---~~CaIClEdY~~GdklRiLP-C~H~FH~~CIDpWL~~~r~~CPvCK~di  277 (348)
T KOG4628|consen  204 RNRLIKRLLKKLPVRTFTKGDDEDAT---DTCAICLEDYEKGDKLRILP-CSHKFHVNCIDPWLTQTRTFCPVCKRDI  277 (348)
T ss_pred             hhhhHHHHHhhCCcEEeccccccCCC---ceEEEeecccccCCeeeEec-CCCchhhccchhhHhhcCccCCCCCCcC
Confidence            55788999999999999876443222   58999999999999999999 9999999999999998865 99999864



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF13436 Gly-zipper_OmpA: Glycine-zipper containing OmpA-like membrane domain Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF13441 Gly-zipper_YMGG: YMGG-like Gly-zipper Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13488 Gly-zipper_Omp: Glycine zipper Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05433 Rick_17kDa_Anti: Glycine zipper 2TM domain; InterPro: IPR008816 This domain includes a putative two transmembrane alpha-helical region that contains glycine zipper motifs [] Back     alignment and domain information
>PF13436 Gly-zipper_OmpA: Glycine-zipper containing OmpA-like membrane domain Back     alignment and domain information
>PF13441 Gly-zipper_YMGG: YMGG-like Gly-zipper Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13488 Gly-zipper_Omp: Glycine zipper Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK10510 putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10510 putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>PRK11280 hypothetical protein; Provisional Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10540 lipoprotein; Provisional Back     alignment and domain information
>TIGR03789 pdsO proteobacterial sortase system OmpA family protein Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF06897 DUF1269: Protein of unknown function (DUF1269); InterPro: IPR009200 There are currently no experimental data for members of this group or their homologues Back     alignment and domain information
>PF06897 DUF1269: Protein of unknown function (DUF1269); InterPro: IPR009200 There are currently no experimental data for members of this group or their homologues Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PLN02720 complex II Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG3005 consensus GIY-YIG type nuclease [General function prediction only] Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>PF05433 Rick_17kDa_Anti: Glycine zipper 2TM domain; InterPro: IPR008816 This domain includes a putative two transmembrane alpha-helical region that contains glycine zipper motifs [] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4803 Predicted membrane protein [Function unknown] Back     alignment and domain information
>KOG1829 consensus Uncharacterized conserved protein, contains C1, PH and RUN domains [Signal transduction mechanisms] Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF05818 TraT: Enterobacterial TraT complement resistance protein; InterPro: IPR008874 The traT gene is one of the F factor transfer genes and encodes an outer membrane protein which is involved in interactions between Escherichia coli and its surroundings [] Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>COG4803 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PRK11677 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 1e-10
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 2e-10
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 9e-10
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 4e-09
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 7e-09
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 1e-04
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure

Iteration: 1

Score = 62.8 bits (151), Expect = 1e-10, Method: Composition-based stats. Identities = 26/51 (50%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Query: 185 GERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL 235 G + C VC +D+ LGE+ R LP C+H+FH CI WL H SCP+CR+ L Sbjct: 13 GSGLECPVCKEDYALGESVRQLP-CNHLFHDSCIVPWLEQHDSCPVCRKSL 62
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query235
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 1e-28
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 9e-27
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 8e-26
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 1e-24
2ect_A78 Ring finger protein 126; metal binding protein, st 1e-23
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 5e-21
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 1e-17
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-17
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 4e-16
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 3e-13
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 4e-13
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 4e-12
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 6e-12
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 7e-12
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 9e-12
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-10
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 5e-09
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 2e-08
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-08
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-08
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 4e-08
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 4e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 5e-08
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 2e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 3e-07
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 3e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 1e-06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 3e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 1e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 5e-06
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 5e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 2e-05
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 2e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 3e-05
3nw0_A238 Non-structural maintenance of chromosomes element 5e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 5e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 1e-04
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 2e-04
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
 Score =  102 bits (257), Expect = 1e-28
 Identities = 27/84 (32%), Positives = 45/84 (53%), Gaps = 3/84 (3%)

Query: 152 NIFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHH 211
           +      +   + ES+D +P+I +T+ +   A G+ + C +C  ++  G+ A  LP CHH
Sbjct: 7   HHSHMVANPPASKESIDALPEILVTEDH--GAVGQEMCCPICCSEYVKGDVATELP-CHH 63

Query: 212 MFHIPCIDKWLLGHASCPLCRRDL 235
            FH PC+  WL    +CP+CR   
Sbjct: 64  YFHKPCVSIWLQKSGTCPVCRCMF 87


>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.77
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.72
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.67
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.64
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.63
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.61
2ect_A78 Ring finger protein 126; metal binding protein, st 99.61
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.55
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.53
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.52
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.51
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.5
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.49
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.48
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.47
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.46
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.46
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.46
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.45
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.44
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.43
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.41
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.39
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.39
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.39
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.34
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.33
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.33
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.32
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.31
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.31
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.31
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.3
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.29
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.29
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.27
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.26
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.26
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.25
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.24
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.24
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.18
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.18
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.17
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.15
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.15
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.14
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.13
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.11
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.1
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.08
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.06
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.05
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.99
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.98
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.96
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 98.91
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.91
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.89
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.87
2ea5_A68 Cell growth regulator with ring finger domain prot 98.8
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.78
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.74
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.73
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.66
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.59
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.51
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.47
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.3
3nw0_A238 Non-structural maintenance of chromosomes element 98.08
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 95.74
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.65
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 95.64
1wil_A89 KIAA1045 protein; ring finger domain, structural g 94.74
1we9_A64 PHD finger family protein; structural genomics, PH 94.7
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 94.35
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 93.01
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 92.92
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 91.48
2k16_A75 Transcription initiation factor TFIID subunit 3; p 91.26
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 91.21
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 90.85
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 90.75
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 90.62
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 89.85
3o70_A68 PHD finger protein 13; PHF13, structural genomics 89.39
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 88.95
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 88.8
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 88.24
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 88.04
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 87.94
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 87.63
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 87.47
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 87.34
1wee_A72 PHD finger family protein; structural genomics, PH 86.18
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 85.96
1weu_A91 Inhibitor of growth family, member 4; structural g 85.84
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 85.73
1wem_A76 Death associated transcription factor 1; structura 85.49
1wew_A78 DNA-binding family protein; structural genomics, P 85.38
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 84.9
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 84.81
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 84.8
2yt5_A66 Metal-response element-binding transcription facto 83.01
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 82.85
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 82.65
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 82.46
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 81.6
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 81.5
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 81.06
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 80.98
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 80.22
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.77  E-value=5e-19  Score=131.59  Aligned_cols=80  Identities=34%  Similarity=0.819  Sum_probs=68.8

Q ss_pred             ccccCCCCCCCHHHHhcCCceeeccCCCcCCCCCCccCccccccccCCCceeecCCCCCcccHhhHHHHHhcCCCCCCcc
Q 026690          153 IFDTGLSKGLTGESVDKIPKITITDKNNIDASGERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCR  232 (235)
Q Consensus       153 ~~~~~~~~gls~~~i~~lp~~~~~~~~~~~~~~e~~~C~ICle~f~~ge~v~~Lp~C~H~FH~~CI~~WL~~~~sCPlCR  232 (235)
                      .......++++++.++++|...++....  ..+++..|+||+++|..++.++.+| |+|.||..||++|++++.+||+||
T Consensus         8 ~~~~~~~~~~s~~~i~~lp~~~~~~~~~--~~~~~~~C~IC~~~~~~~~~~~~l~-C~H~Fh~~Ci~~wl~~~~~CP~Cr   84 (91)
T 2l0b_A            8 HSHMVANPPASKESIDALPEILVTEDHG--AVGQEMCCPICCSEYVKGDVATELP-CHHYFHKPCVSIWLQKSGTCPVCR   84 (91)
T ss_dssp             SCCSSCCCCCCHHHHHTSCEEECCTTCS--SSSSCSEETTTTEECCTTCEEEEET-TTEEEEHHHHHHHHTTTCBCTTTC
T ss_pred             CCCCcCCCCCCHHHHHhCCCeeeccccc--ccCCCCCCcccChhhcCCCcEEecC-CCChHHHHHHHHHHHcCCcCcCcC
Confidence            3445678899999999999998876432  2345678999999999999999999 999999999999999999999999


Q ss_pred             CCC
Q 026690          233 RDL  235 (235)
Q Consensus       233 ~~v  235 (235)
                      +++
T Consensus        85 ~~~   87 (91)
T 2l0b_A           85 CMF   87 (91)
T ss_dssp             CBS
T ss_pred             ccC
Confidence            865



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 235
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 6e-19
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 2e-12
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 3e-11
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 5e-11
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-10
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-09
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 3e-08
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 4e-08
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 3e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-06
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 3e-06
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 1e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 7e-04
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 75.3 bits (185), Expect = 6e-19
 Identities = 25/50 (50%), Positives = 33/50 (66%)

Query: 186 ERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL 235
           + V C+VCL + + GE AR LP C H FH  C+D WL  H++CPLCR  +
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV 53


>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query235
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.78
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.58
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.53
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.53
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.49
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.48
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.48
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.41
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.3
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.28
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.27
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.22
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.12
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.08
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.07
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.04
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.72
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 95.57
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 95.45
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 92.9
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 92.41
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 92.22
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 91.07
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 90.05
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 89.8
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 88.22
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 87.99
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 87.87
d1wema_76 Death associated transcription factor 1, Datf1 (DI 87.8
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 84.71
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 84.58
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 84.21
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 82.43
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.78  E-value=4.9e-20  Score=123.89  Aligned_cols=51  Identities=49%  Similarity=1.107  Sum_probs=47.0

Q ss_pred             CCCccCccccccccCCCceeecCCCCCcccHhhHHHHHhcCCCCCCccCCC
Q 026690          185 GERVSCSVCLQDFQLGETARSLPHCHHMFHIPCIDKWLLGHASCPLCRRDL  235 (235)
Q Consensus       185 ~e~~~C~ICle~f~~ge~v~~Lp~C~H~FH~~CI~~WL~~~~sCPlCR~~v  235 (235)
                      +++.+|+||+++|+.++.+..+|.|+|.||..||.+|++++++||+||++|
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i   53 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV   53 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCS
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEe
Confidence            345689999999999999999888999999999999999999999999976



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure