Citrus Sinensis ID: 026701


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MAVSSLSLNWVSTTLSKKLNVAYPNELTRSATAFSCQNFFTCPEDISSDEENKSKRRLLLMGAGLLTANLLPANSLFAQEIPKNYDAFVDRIDGYSYVYPSDWTEFEFTGHDSGFKDRYLQLQNVRVRFIPTDKKDVHDLGPMEEVVSNLARHVYAAPNQVADILDMQEKSVDGKNYYTFEYILTSPNYSSASIATIAIANGRYYTLIVGANERRWKRVRNKLKVVADSFRILDI
ccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccEEEEcccccEEcccccccccccccccccccEEEEEEccccccccccccHHHHHHHHHHHHHccccccEEEEEEEEEECccCEEEEEEEEEEcccccCEEEEEEEEEccEEEEEEEEEcHHHHHHHHHHHHHHHcccEEEEc
*******LNWVSTTLSKKLNVAYPNELTRSATAFSCQNF*****************RLLLMGAGLLTANLLPANSLFAQEIPKNYDAFVDRIDGYSYVYPSDWTEFEFTGHDSGFKDRYLQLQNVRVRFIPTDKKDVHDLGPMEEVVSNLARHVYAAPNQVADILDMQEKSVDGKNYYTFEYILTSPNYSSASIATIAIANGRYYTLIVGANERRWKRVRNKLKVVADSFRILDI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVSSLSLNWVSTTLSKKLNVAYPNELTRSATAFSCQNFFTCPEDISSDEENKSKRRLLLMGAGLLTANLLPANSLFAQEIPKNYDAFVDRIDGYSYVYPSDWTEFEFTGHDSGFKDRYLQLQNVRVRFIPTDKKDVHDLGPMEEVVSNLARHVYAAPNQVADILDMQEKSVDGKNYYTFEYILTSPNYSSASIATIAIANGRYYTLIVGANERRWKRVRNKLKVVADSFRILDI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PsbP-like protein 2, chloroplastic Required for accumulation of the chloroplast NAD(P)H dehydrogenase (NDH) complex. May be a subunit of this complex.probableO80634

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LNJ, chain A
Confidence level:very confident
Coverage over the Query: 80-233
View the alignment between query and template
View the model in PyMOL
Template: 2VU4, chain A
Confidence level:confident
Coverage over the Query: 85-232
View the alignment between query and template
View the model in PyMOL