Citrus Sinensis ID: 026712


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
MSSISIPSCLTLARLNANGVINSVPHLQLPITVATPSHLSKRLRFFTVSREVKAFAHNGVGITNSVPPRNGTYTVGDFMTKKEDLHAVKTTTTVDEALERLVEKRITGFPVIDDDWKLVGVVSDYDLLALDSISGGNQNDTSLFPNVNSTWKTFNELQRLLSKTNGKVVGDLMTPAPLVVHENTNLEDAARLLLETKYRRLPVVDGYGKLVGLITRGNVVRAALQIKRDGERST
ccccccccccccccccccccccccccccccccccccccHHHHHHccccHHHHHHHHccccccccccccccccccccccccccccCEEEcccccHHHHHHHHHHccccCEEEEcccccEEEEEEHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccccccccccEEEcccccHHHHHHHHHHccccCCcEEccccEEEEEEEHHHHHHHHHHccccccccc
*****IPSCLTLARLNANGVINSVPHLQLPITVATPSHLSKRLRFFTVSREVKAFAHNGVGITNSVPPRNGTYTVGDFMTKKEDLHAVKTTTTVDEALERLVEKRITGFPVIDDDWKLVGVVSDYDLLALDSISGGNQNDTSLFPNVNSTWKTFNELQRLLSKTNGKVVGDLMTPAPLVVHENTNLEDAARLLLETKYRRLPVVDGYGKLVGLITRGNVVRAALQI********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSISIPSCLTLARLNANGVINSVPHLQLPITVATPSHLSKRLRFFTVSREVKAFAHNGVGITNSVPPRNGTYTVGDFMTKKEDLHAVKTTTTVDEALERLVEKRITGFPVIDDDWKLVGVVSDYDLLALDSISGGNQNDTSLFPNVNSTWKTFNELQRLLSKTNGKVVGDLMTPAPLVVHENTNLEDAARLLLETKYRRLPVVDGYGKLVGLITRGNVVRAALQIKRDGERST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CBS domain-containing protein CBSX1, chloroplastic probableO23193
CBS domain-containing protein CBSX2, chloroplastic probableQ9C5D0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YZQ, chain A
Confidence level:very confident
Coverage over the Query: 71-135,165-224
View the alignment between query and template
View the model in PyMOL
Template: 1VR9, chain A
Confidence level:very confident
Coverage over the Query: 14-135,168
View the alignment between query and template
View the model in PyMOL