Citrus Sinensis ID: 026727
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 234 | ||||||
| 363807182 | 344 | uncharacterized protein LOC100810870 [Gl | 0.901 | 0.613 | 0.787 | 1e-95 | |
| 363808134 | 348 | uncharacterized protein LOC100811411 [Gl | 0.901 | 0.606 | 0.789 | 1e-94 | |
| 224102117 | 344 | predicted protein [Populus trichocarpa] | 0.910 | 0.619 | 0.780 | 2e-94 | |
| 225432798 | 345 | PREDICTED: auxin-induced protein PCNT115 | 0.910 | 0.617 | 0.780 | 2e-93 | |
| 255552045 | 350 | aldo/keto reductase, putative [Ricinus c | 0.910 | 0.608 | 0.766 | 1e-92 | |
| 255552041 | 343 | aldo/keto reductase, putative [Ricinus c | 0.897 | 0.612 | 0.759 | 4e-90 | |
| 449494865 | 345 | PREDICTED: LOW QUALITY PROTEIN: perakine | 0.901 | 0.611 | 0.740 | 2e-87 | |
| 449455310 | 345 | PREDICTED: LOW QUALITY PROTEIN: perakine | 0.901 | 0.611 | 0.740 | 3e-87 | |
| 255542306 | 350 | aldo/keto reductase, putative [Ricinus c | 0.905 | 0.605 | 0.736 | 2e-86 | |
| 356573095 | 346 | PREDICTED: LOW QUALITY PROTEIN: auxin-in | 0.884 | 0.598 | 0.735 | 2e-85 |
| >gi|363807182|ref|NP_001242349.1| uncharacterized protein LOC100810870 [Glycine max] gi|255644406|gb|ACU22708.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 354 bits (909), Expect = 1e-95, Method: Compositional matrix adjust.
Identities = 167/212 (78%), Positives = 190/212 (89%), Gaps = 1/212 (0%)
Query: 3 EKPQVHVPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTS 62
EK Q+HVPRVKLGSQGLE+SRLGFGC GLSG+YN PLSHE GCSIIKE FN G+T FDTS
Sbjct: 2 EKLQLHVPRVKLGSQGLEISRLGFGCVGLSGLYNAPLSHEAGCSIIKEAFNMGVTFFDTS 61
Query: 63 DVYGVDHDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKR 122
D YG++HDNEIM+GKALK+LPR+K+QLATKFG DGV GVKG+PEYVR+CCEASLKR
Sbjct: 62 DFYGLNHDNEIMIGKALKELPREKVQLATKFGLVRSDGVFAGVKGTPEYVRQCCEASLKR 121
Query: 123 LDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITA 182
LDV+YIDLYYQHRVDTSV IEDTMGELKKLV EGKIKYIGLS+AS DT++RAHAVHPI+A
Sbjct: 122 LDVEYIDLYYQHRVDTSVPIEDTMGELKKLVNEGKIKYIGLSQASPDTMKRAHAVHPISA 181
Query: 183 VQMEYSLWTREIEDDIIPLCRFLHI-FLPYNP 213
+QMEYSLWTR+IE++IIPLCR L I + Y+P
Sbjct: 182 LQMEYSLWTRDIEEEIIPLCRELGIGIVAYSP 213
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|363808134|ref|NP_001242478.1| uncharacterized protein LOC100811411 [Glycine max] gi|255637199|gb|ACU18930.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224102117|ref|XP_002312553.1| predicted protein [Populus trichocarpa] gi|222852373|gb|EEE89920.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225432798|ref|XP_002283471.1| PREDICTED: auxin-induced protein PCNT115 [Vitis vinifera] gi|297737113|emb|CBI26314.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255552045|ref|XP_002517067.1| aldo/keto reductase, putative [Ricinus communis] gi|223543702|gb|EEF45230.1| aldo/keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|255552041|ref|XP_002517065.1| aldo/keto reductase, putative [Ricinus communis] gi|223543700|gb|EEF45228.1| aldo/keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449494865|ref|XP_004159668.1| PREDICTED: LOW QUALITY PROTEIN: perakine reductase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449455310|ref|XP_004145396.1| PREDICTED: LOW QUALITY PROTEIN: perakine reductase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255542306|ref|XP_002512216.1| aldo/keto reductase, putative [Ricinus communis] gi|223548177|gb|EEF49668.1| aldo/keto reductase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356573095|ref|XP_003554700.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein PCNT115-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 234 | ||||||
| TAIR|locus:2036504 | 345 | ATB2 [Arabidopsis thaliana (ta | 0.867 | 0.588 | 0.635 | 3.3e-63 | |
| TAIR|locus:2036591 | 346 | AT1G60680 "AT1G60680" [Arabido | 0.871 | 0.589 | 0.621 | 1.1e-62 | |
| TAIR|locus:2036551 | 330 | AT1G60750 [Arabidopsis thalian | 0.893 | 0.633 | 0.610 | 1.1e-62 | |
| TAIR|locus:2036611 | 345 | AT1G60690 "AT1G60690" [Arabido | 0.867 | 0.588 | 0.611 | 3.4e-61 | |
| TAIR|locus:2196446 | 344 | AT1G10810 "AT1G10810" [Arabido | 0.863 | 0.587 | 0.608 | 8.1e-60 | |
| TIGR_CMR|SPO_A0345 | 327 | SPO_A0345 "oxidoreductase, ald | 0.850 | 0.608 | 0.521 | 3.3e-47 | |
| TIGR_CMR|GSU_3126 | 334 | GSU_3126 "oxidoreductase, aldo | 0.846 | 0.592 | 0.463 | 1.7e-41 | |
| UNIPROTKB|G4NAH9 | 341 | MGG_09715 "Aldo-keto reductase | 0.871 | 0.598 | 0.428 | 4.3e-38 | |
| POMBASE|SPAC1F7.12 | 340 | yak3 "aldose reductase ARK13 f | 0.782 | 0.538 | 0.465 | 1.5e-35 | |
| ASPGD|ASPL0000072041 | 351 | AN8733 [Emericella nidulans (t | 0.833 | 0.555 | 0.410 | 2e-33 |
| TAIR|locus:2036504 ATB2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 645 (232.1 bits), Expect = 3.3e-63, P = 3.3e-63
Identities = 131/206 (63%), Positives = 155/206 (75%)
Query: 9 VPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVD 68
V R+KLGSQGLEVS G GC GLS Y P ++I + G+TL DTSD+YG +
Sbjct: 7 VRRMKLGSQGLEVSAQGLGCMGLSAFYGAPKPENEAIALIHHAIHSGVTLLDTSDIYGPE 66
Query: 69 HDNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYI 128
NE+++GKALK R+K++LATKFG +G V+G PEYVR CEASLKRLD+ I
Sbjct: 67 -TNEVLLGKALKDGVREKVELATKFGISYAEGKR-EVRGDPEYVRAACEASLKRLDIACI 124
Query: 129 DLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYS 188
DLYYQHRVDT V IE TMGELKKLVEEGKIKYIGLSEASA TIRRAHAVHPITAVQ+E+S
Sbjct: 125 DLYYQHRVDTRVPIEITMGELKKLVEEGKIKYIGLSEASASTIRRAHAVHPITAVQIEWS 184
Query: 189 LWTREIEDDIIPLCRFLHI-FLPYNP 213
LWTR++E++IIP CR L I + Y+P
Sbjct: 185 LWTRDVEEEIIPTCRELGIGIVAYSP 210
|
|
| TAIR|locus:2036591 AT1G60680 "AT1G60680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036551 AT1G60750 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2036611 AT1G60690 "AT1G60690" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2196446 AT1G10810 "AT1G10810" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_A0345 SPO_A0345 "oxidoreductase, aldo/keto reductase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3126 GSU_3126 "oxidoreductase, aldo/keto reductase family" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NAH9 MGG_09715 "Aldo-keto reductase yakc" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC1F7.12 yak3 "aldose reductase ARK13 family YakC" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000072041 AN8733 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00081480 | hypothetical protein (344 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 234 | |||
| cd06660 | 285 | cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) | 8e-72 | |
| COG0667 | 316 | COG0667, Tas, Predicted oxidoreductases (related t | 1e-71 | |
| pfam00248 | 277 | pfam00248, Aldo_ket_red, Aldo/keto reductase famil | 1e-54 | |
| COG0656 | 280 | COG0656, ARA1, Aldo/keto reductases, related to di | 3e-34 | |
| PLN02587 | 314 | PLN02587, PLN02587, L-galactose dehydrogenase | 4e-24 | |
| COG4989 | 298 | COG4989, COG4989, Predicted oxidoreductase [Genera | 2e-22 | |
| COG1453 | 391 | COG1453, COG1453, Predicted oxidoreductases of the | 1e-20 | |
| PRK09912 | 346 | PRK09912, PRK09912, L-glyceraldehyde 3-phosphate r | 3e-18 | |
| PRK10376 | 290 | PRK10376, PRK10376, putative oxidoreductase; Provi | 5e-14 | |
| TIGR01293 | 317 | TIGR01293, Kv_beta, voltage-dependent potassium ch | 1e-13 | |
| PRK10625 | 346 | PRK10625, tas, putative aldo-keto reductase; Provi | 5e-12 | |
| PRK11565 | 275 | PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A | 1e-08 | |
| PRK11172 | 267 | PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B | 1e-05 |
| >gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
Score = 220 bits (562), Expect = 8e-72
Identities = 83/208 (39%), Positives = 121/208 (58%), Gaps = 13/208 (6%)
Query: 11 RVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHD 70
LG GL+VSRLG G L G Y + E + ++ + GI DT+DVYG D +
Sbjct: 1 YRTLGKTGLKVSRLGLGTWQLGGGY---VDEEEAAAAVRAALDAGINFIDTADVYG-DGE 56
Query: 71 NEIMVGKALKQLP-RDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYID 129
+E ++G+ALK+ R+++ +ATK G DG SPE++R+ E SLKRL DYID
Sbjct: 57 SEELLGEALKERGPREEVFIATKVGPRPGDGR----DLSPEHIRRAVEESLKRLGTDYID 112
Query: 130 LYYQHRVDTSV-SIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAV--HPITAVQME 186
LY H D IE+T+ L++LV+EGKI+ IG+S SA+ + A A P Q+E
Sbjct: 113 LYLLHWPDPDTPDIEETLRALEELVKEGKIRAIGVSNFSAEQLEEALAAAGVPPAVNQVE 172
Query: 187 YSLWTREIEDDIIPLCRFLHI-FLPYNP 213
Y+L R+ E++++P CR I + Y+P
Sbjct: 173 YNLLDRQAEEELLPYCREHGIGVIAYSP 200
|
AKRs are present in all phyla and are of importance to both health and industrial applications. Members have very distinct functions and include the prokaryotic 2,5-diketo-D-gluconic acid reductases and beta-keto ester reductases, the eukaryotic aldose reductases, aldehyde reductases, hydroxysteroid dehydrogenases, steroid 5beta-reductases, potassium channel beta-subunits and aflatoxin aldehyde reductases, among others. Length = 285 |
| >gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family | Back alignment and domain information |
|---|
| >gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|227322 COG4989, COG4989, Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182140 PRK09912, PRK09912, L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236676 PRK10376, PRK10376, putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|213602 TIGR01293, Kv_beta, voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >gnl|CDD|236727 PRK10625, tas, putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 234 | |||
| COG0667 | 316 | Tas Predicted oxidoreductases (related to aryl-alc | 100.0 | |
| KOG1575 | 336 | consensus Voltage-gated shaker-like K+ channel, su | 100.0 | |
| COG0656 | 280 | ARA1 Aldo/keto reductases, related to diketogulona | 100.0 | |
| KOG1577 | 300 | consensus Aldo/keto reductase family proteins [Gen | 100.0 | |
| TIGR01293 | 317 | Kv_beta voltage-dependent potassium channel beta s | 100.0 | |
| PRK09912 | 346 | L-glyceraldehyde 3-phosphate reductase; Provisiona | 100.0 | |
| cd06660 | 285 | Aldo_ket_red Aldo-keto reductases (AKRs) are a sup | 100.0 | |
| PRK10625 | 346 | tas putative aldo-keto reductase; Provisional | 100.0 | |
| PLN02587 | 314 | L-galactose dehydrogenase | 100.0 | |
| PRK10376 | 290 | putative oxidoreductase; Provisional | 100.0 | |
| PRK11172 | 267 | dkgB 2,5-diketo-D-gluconate reductase B; Provision | 100.0 | |
| PRK14863 | 292 | bifunctional regulator KidO; Provisional | 100.0 | |
| PF00248 | 283 | Aldo_ket_red: Aldo/keto reductase family; InterPro | 100.0 | |
| COG4989 | 298 | Predicted oxidoreductase [General function predict | 100.0 | |
| PRK11565 | 275 | dkgA 2,5-diketo-D-gluconate reductase A; Provision | 100.0 | |
| COG1453 | 391 | Predicted oxidoreductases of the aldo/keto reducta | 100.0 | |
| KOG1576 | 342 | consensus Predicted oxidoreductase [Energy product | 100.0 | |
| KOG3023 | 285 | consensus Glutamate-cysteine ligase regulatory sub | 98.44 | |
| cd03319 | 316 | L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat | 93.95 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 92.78 | |
| PRK08392 | 215 | hypothetical protein; Provisional | 92.61 | |
| TIGR02370 | 197 | pyl_corrinoid methyltransferase cognate corrinoid | 91.58 | |
| cd02070 | 201 | corrinoid_protein_B12-BD B12 binding domain of cor | 90.85 | |
| PRK10550 | 312 | tRNA-dihydrouridine synthase C; Provisional | 90.68 | |
| KOG0259 | 447 | consensus Tyrosine aminotransferase [Amino acid tr | 89.64 | |
| cd03174 | 265 | DRE_TIM_metallolyase DRE-TIM metallolyase superfam | 88.67 | |
| COG0135 | 208 | TrpF Phosphoribosylanthranilate isomerase [Amino a | 88.42 | |
| PRK08609 | 570 | hypothetical protein; Provisional | 87.43 | |
| cd03316 | 357 | MR_like Mandelate racemase (MR)-like subfamily of | 87.21 | |
| PRK13958 | 207 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 86.39 | |
| COG2089 | 347 | SpsE Sialic acid synthase [Cell envelope biogenesi | 84.71 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 84.31 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 83.72 | |
| COG1140 | 513 | NarY Nitrate reductase beta subunit [Energy produc | 81.81 | |
| cd00308 | 229 | enolase_like Enolase-superfamily, characterized by | 81.37 | |
| cd03315 | 265 | MLE_like Muconate lactonizing enzyme (MLE) like su | 81.29 | |
| cd04740 | 296 | DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c | 81.12 | |
| cd02069 | 213 | methionine_synthase_B12_BD B12 binding domain of m | 80.95 | |
| PRK01222 | 210 | N-(5'-phosphoribosyl)anthranilate isomerase; Provi | 80.53 | |
| PF03102 | 241 | NeuB: NeuB family; InterPro: IPR013132 NeuB is the | 80.46 | |
| COG3172 | 187 | NadR Predicted ATPase/kinase involved in NAD metab | 80.32 | |
| COG0635 | 416 | HemN Coproporphyrinogen III oxidase and related Fe | 80.28 |
| >COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.5e-53 Score=360.76 Aligned_cols=207 Identities=43% Similarity=0.623 Sum_probs=186.9
Q ss_pred CcceecCCCCcccCcceecccccCCCCCCCCCHHHHHHHHHHHHHcCCCEEeCCcCcCCCChhHHHHHHHHhcCC-CCce
Q 026727 9 VPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLP-RDKI 87 (234)
Q Consensus 9 m~~~~lg~~g~~vs~lglG~~~~~~~~~~~~~~~~~~~~l~~A~~~Gin~~DtA~~Yg~~g~sE~~lg~al~~~~-R~~~ 87 (234)
|++++||++|++||+||||||.+|+.+. ..+.+++.++|++|+++||||||||+.||. |.||+++|+||++.. |+++
T Consensus 1 m~~r~lG~~gl~vs~lglG~~~~g~~~~-~~~~~~a~~il~~A~d~Gin~~DTA~~Yg~-g~sE~ilG~~l~~~~~Rd~v 78 (316)
T COG0667 1 MKYRRLGRSGLKVSPLGLGTMTLGGDTD-DEEEAEAIEILDAALDAGINFFDTADVYGD-GRSEEILGEALKERGRRDKV 78 (316)
T ss_pred CCceecCCCCceecceeeeccccCCCCC-chhhhHHHHHHHHHHHcCCCEEECccccCC-CchHHHHHHHHhccCCCCeE
Confidence 7899999999999999999999987422 225567888999999999999999999998 899999999999744 8999
Q ss_pred EEEeeeccccCCCCCc-CCCCCHHHHHHHHHHHHHHcCCCccCeEEEecCCCCCCHHHHHHHHHHHHHcCcccEEecCCC
Q 026727 88 QLATKFGCFMLDGVSI-GVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEA 166 (234)
Q Consensus 88 ~i~tK~~~~~~~~~~~-~~~~~~~~i~~~~~~sL~~Lg~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvsn~ 166 (234)
+|+||++....++... ..+.+++.|+++++.||+||||||||+|++|||+...+.++++++|.+|+++|+||+||+||+
T Consensus 79 vIaTK~g~~~~~~~~~~~~~~s~~~i~~~v~~SL~RLgtd~IDl~~iH~~d~~~p~~e~~~aL~~l~~~G~ir~iG~S~~ 158 (316)
T COG0667 79 VIATKVGYRPGDPGPNGVFGLSRDHIRRAVEASLKRLGTDYIDLYQLHRPDPETPIEETLEALDELVREGKIRYIGVSNY 158 (316)
T ss_pred EEEEeeccCCCCCCCCccCCCCHHHHHHHHHHHHHHhCCCceeEEEeCCCCCCCCHHHHHHHHHHHHHcCCeeEEEecCC
Confidence 9999998766421112 356899999999999999999999999999999999999999999999999999999999999
Q ss_pred cHHHHHHHhhc-CCeeEEeecCCCCCCCchhcHHHHHHHCCe-EEEeecccCC
Q 026727 167 SADTIRRAHAV-HPITAVQMEYSLWTREIEDDIIPLCRFLHI-FLPYNPSFCL 217 (234)
Q Consensus 167 ~~~~l~~~~~~-~~~~~~q~~~n~~~~~~~~~l~~~~~~~gi-v~a~spl~~G 217 (234)
+++++.++++. .+++++|.+||+++++.+.+++++|+++|| +++||||+.|
T Consensus 159 ~~~~i~~a~~~~~~~~~~Q~~ynl~~R~~e~~l~~~~~~~gi~~~~~spla~G 211 (316)
T COG0667 159 SAEQIAEALAVAAPIDSLQPEYNLLERDAEKELLPLCREEGIGLLAYSPLASG 211 (316)
T ss_pred CHHHHHHHHHhcCCceeecccCccccccchhHHHHHHHHcCCeEEEecCcccc
Confidence 99999999998 599999999999998777779999999999 9999999555
|
|
| >KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal | Back alignment and domain information |
|---|
| >PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols | Back alignment and domain information |
|---|
| >PRK10625 tas putative aldo-keto reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02587 L-galactose dehydrogenase | Back alignment and domain information |
|---|
| >PRK10376 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional | Back alignment and domain information |
|---|
| >PRK14863 bifunctional regulator KidO; Provisional | Back alignment and domain information |
|---|
| >PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] | Back alignment and domain information |
|---|
| >COG4989 Predicted oxidoreductase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional | Back alignment and domain information |
|---|
| >COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG3023 consensus Glutamate-cysteine ligase regulatory subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >PRK08392 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family | Back alignment and domain information |
|---|
| >cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins | Back alignment and domain information |
|---|
| >PRK10550 tRNA-dihydrouridine synthase C; Provisional | Back alignment and domain information |
|---|
| >KOG0259 consensus Tyrosine aminotransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily | Back alignment and domain information |
|---|
| >COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08609 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily | Back alignment and domain information |
|---|
| >PRK13958 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd00308 enolase_like Enolase-superfamily, characterized by the presence of an enolate anion intermediate which is generated by abstraction of the alpha-proton of the carboxylate substrate by an active site residue and is stabilized by coordination to the essential Mg2+ ion | Back alignment and domain information |
|---|
| >cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily | Back alignment and domain information |
|---|
| >cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain | Back alignment and domain information |
|---|
| >cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase | Back alignment and domain information |
|---|
| >PRK01222 N-(5'-phosphoribosyl)anthranilate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) | Back alignment and domain information |
|---|
| >COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 234 | ||||
| 3v0u_A | 338 | Crystal Structure Of Perakine Reductase, Founder Me | 3e-83 | ||
| 3uyi_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 1e-82 | ||
| 3v0t_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 2e-82 | ||
| 3v0s_A | 337 | Crystal Structure Of Perakine Reductase, Founder Me | 3e-79 | ||
| 1pyf_A | 312 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 5e-26 | ||
| 1pz1_A | 333 | Structure Of Nadph-Dependent Family 11 Aldo-Keto Re | 3e-23 | ||
| 3n2t_A | 348 | Structure Of The Glycerol Dehydrogenase Akr11b4 Fro | 4e-21 | ||
| 3erp_A | 353 | Structure Of Idp01002, A Putative Oxidoreductase Fr | 7e-19 | ||
| 1ynp_A | 317 | Aldo-keto Reductase Akr11c1 From Bacillus Haloduran | 8e-19 | ||
| 3n6q_A | 346 | Crystal Structure Of Yghz From E. Coli Length = 346 | 3e-15 | ||
| 4aub_A | 366 | The Complex Structure Of The Bacterial Aldo-Keto Re | 4e-15 | ||
| 1zsx_A | 347 | Crystal Structure Of Human Potassium Channel Kv Bet | 1e-12 | ||
| 1qrq_A | 325 | Structure Of A Voltage-Dependent K+ Channel Beta Su | 1e-12 | ||
| 3eau_A | 327 | Voltage-Dependent K+ Channel Beta Subunit In Comple | 2e-12 | ||
| 3eb4_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (I211r) I | 2e-12 | ||
| 3eb3_A | 327 | Voltage-Dependent K+ Channel Beta Subunit (W121a) I | 2e-12 | ||
| 2a79_A | 333 | Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu | 2e-12 | ||
| 3lut_A | 367 | A Structural Model For The Full-Length Shaker Potas | 2e-12 | ||
| 1exb_A | 332 | Structure Of The Cytoplasmic Beta Subunit-T1 Assemb | 2e-12 | ||
| 2bp1_B | 360 | Structure Of The Aflatoxin Aldehyde Reductase In Co | 2e-11 | ||
| 2c91_A | 338 | Mouse Succinic Semialdehyde Reductase, Akr7a5 Lengt | 3e-10 | ||
| 2clp_A | 347 | Crystal Structure Of Human Aflatoxin B1 Aldehyde Re | 5e-10 | ||
| 1og6_A | 298 | Ydhf, An Aldo-keto Reductase From E.coli Complexed | 9e-10 | ||
| 1gve_A | 327 | Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Live | 3e-09 | ||
| 1ur3_M | 319 | Crystal Structure Of The Apo Form Of The E.Coli Ydh | 6e-09 | ||
| 3o0k_A | 283 | Crystal Structure Of AldoKETO REDUCTASE FROM BRUCEL | 3e-08 | ||
| 1lqa_A | 346 | Tas Protein From Escherichia Coli In Complex With N | 3e-08 | ||
| 3up8_A | 298 | Crystal Structure Of A Putative 2,5-Diketo-D-Glucon | 6e-08 | ||
| 2wzm_A | 283 | Crystal Structure Of A Mycobacterium Aldo-Keto Redu | 2e-07 | ||
| 1qwk_A | 317 | Structural Genomics Of Caenorhabditis Elegans: Hypo | 4e-06 | ||
| 1jez_A | 322 | The Structure Of Xylose Reductase, A Dimeric Aldo-K | 1e-05 | ||
| 1ye4_A | 322 | Crystal Structure Of The Lys-274 To Arg Mutant Of C | 1e-05 | ||
| 1z9a_A | 321 | Crystal Structure Of The Asn-309 To Asp Mutant Of C | 1e-05 | ||
| 1sm9_A | 322 | Crystal Structure Of An Engineered K274rn276d Doubl | 1e-05 | ||
| 2bgq_A | 344 | Apo Aldose Reductase From Barley Length = 344 | 2e-05 | ||
| 4exa_A | 292 | Crystal Structure Of The Pa4992, The Putative Aldo- | 2e-05 | ||
| 1r38_A | 322 | Crystal Structure Of H114a Mutant Of Candida Tenuis | 3e-05 | ||
| 3krb_A | 334 | Structure Of Aldose Reductase From Giardia Lamblia | 4e-05 | ||
| 1vp5_A | 298 | Crystal Structure Of 2,5-diketo-d-gluconic Acid Red | 6e-05 | ||
| 4gac_A | 324 | High Resolution Structure Of Mouse Aldehyde Reducta | 1e-04 | ||
| 3cv7_A | 325 | Crystal Structure Of Porcine Aldehyde Reductase Ter | 3e-04 | ||
| 1cwn_A | 324 | Crystal Structure Of Porcine Aldehyde Reductase Hol | 3e-04 | ||
| 1ae4_A | 325 | Aldehyde Reductase Complexed With Cofactor And Inhi | 4e-04 | ||
| 4f40_A | 288 | X-Ray Crystal Structure Of Apo Prostaglandin F Synt | 5e-04 | ||
| 1mzr_A | 296 | Structure Of Dkga From E.Coli At 2.13 A Resolution | 6e-04 | ||
| 1hqt_A | 326 | The Crystal Structure Of An Aldehyde Reductase Y50f | 9e-04 |
| >pdb|3V0U|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 338 | Back alignment and structure |
|
| >pdb|3UYI|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3V0T|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|3V0S|A Chain A, Crystal Structure Of Perakine Reductase, Founder Member Of A Novel Akr Subfamily With Unique Conformational Changes During Nadph Binding Length = 337 | Back alignment and structure |
| >pdb|1PYF|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11a(Apo) Length = 312 | Back alignment and structure |
| >pdb|1PZ1|A Chain A, Structure Of Nadph-Dependent Family 11 Aldo-Keto Reductase Akr11b(Holo) Length = 333 | Back alignment and structure |
| >pdb|3N2T|A Chain A, Structure Of The Glycerol Dehydrogenase Akr11b4 From Gluconobacter Oxydans Length = 348 | Back alignment and structure |
| >pdb|3ERP|A Chain A, Structure Of Idp01002, A Putative Oxidoreductase From And Essential Gene Of Salmonella Typhimurium Length = 353 | Back alignment and structure |
| >pdb|1YNP|A Chain A, Aldo-keto Reductase Akr11c1 From Bacillus Halodurans (apo Form) Length = 317 | Back alignment and structure |
| >pdb|3N6Q|A Chain A, Crystal Structure Of Yghz From E. Coli Length = 346 | Back alignment and structure |
| >pdb|4AUB|A Chain A, The Complex Structure Of The Bacterial Aldo-Keto Reductase Akr14a1 With Nadp And Citrate Length = 366 | Back alignment and structure |
| >pdb|1ZSX|A Chain A, Crystal Structure Of Human Potassium Channel Kv Beta-Subunit (Kcnab2) Length = 347 | Back alignment and structure |
| >pdb|1QRQ|A Chain A, Structure Of A Voltage-Dependent K+ Channel Beta Subunit Length = 325 | Back alignment and structure |
| >pdb|3EAU|A Chain A, Voltage-Dependent K+ Channel Beta Subunit In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3EB4|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (I211r) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|3EB3|A Chain A, Voltage-Dependent K+ Channel Beta Subunit (W121a) In Complex With Cortisone Length = 327 | Back alignment and structure |
| >pdb|2A79|A Chain A, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 333 | Back alignment and structure |
| >pdb|3LUT|A Chain A, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 367 | Back alignment and structure |
| >pdb|1EXB|A Chain A, Structure Of The Cytoplasmic Beta Subunit-T1 Assembly Of Voltage-Dependent K Channels Length = 332 | Back alignment and structure |
| >pdb|2C91|A Chain A, Mouse Succinic Semialdehyde Reductase, Akr7a5 Length = 338 | Back alignment and structure |
| >pdb|2CLP|A Chain A, Crystal Structure Of Human Aflatoxin B1 Aldehyde Reductase Member 3 Length = 347 | Back alignment and structure |
| >pdb|1OG6|A Chain A, Ydhf, An Aldo-keto Reductase From E.coli Complexed With Nadph Length = 298 | Back alignment and structure |
| >pdb|1GVE|A Chain A, Aflatoxin Aldehyde Reductase (Akr7a1) From Rat Liver Length = 327 | Back alignment and structure |
| >pdb|1UR3|M Chain M, Crystal Structure Of The Apo Form Of The E.Coli Ydhf Protein Length = 319 | Back alignment and structure |
| >pdb|3O0K|A Chain A, Crystal Structure Of AldoKETO REDUCTASE FROM BRUCELLA MELITENSIS Length = 283 | Back alignment and structure |
| >pdb|1LQA|A Chain A, Tas Protein From Escherichia Coli In Complex With Nadph Length = 346 | Back alignment and structure |
| >pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 | Back alignment and structure |
| >pdb|2WZM|A Chain A, Crystal Structure Of A Mycobacterium Aldo-Keto Reductase In Its Apo And Liganded Form Length = 283 | Back alignment and structure |
| >pdb|1QWK|A Chain A, Structural Genomics Of Caenorhabditis Elegans: Hypothetical 35.2 Kda Protein (Aldose Reductase Family Member) Length = 317 | Back alignment and structure |
| >pdb|1JEZ|A Chain A, The Structure Of Xylose Reductase, A Dimeric Aldo-Keto Reductase From Candida Tenuis Length = 322 | Back alignment and structure |
| >pdb|1YE4|A Chain A, Crystal Structure Of The Lys-274 To Arg Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 322 | Back alignment and structure |
| >pdb|1Z9A|A Chain A, Crystal Structure Of The Asn-309 To Asp Mutant Of Candida Tenuis Xylose Reductase (Akr2b5) Bound To Nad+ Length = 321 | Back alignment and structure |
| >pdb|1SM9|A Chain A, Crystal Structure Of An Engineered K274rn276d Double Mutant Of Xylose Reductase From Candida Tenuis Optimized To Utilize Nad Length = 322 | Back alignment and structure |
| >pdb|2BGQ|A Chain A, Apo Aldose Reductase From Barley Length = 344 | Back alignment and structure |
| >pdb|4EXA|A Chain A, Crystal Structure Of The Pa4992, The Putative Aldo-keto Reductase From Pseudomona Aeruginosa Length = 292 | Back alignment and structure |
| >pdb|1R38|A Chain A, Crystal Structure Of H114a Mutant Of Candida Tenuis Xylose Reductase Length = 322 | Back alignment and structure |
| >pdb|3KRB|A Chain A, Structure Of Aldose Reductase From Giardia Lamblia At 1.75a Resolution Length = 334 | Back alignment and structure |
| >pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 | Back alignment and structure |
| >pdb|4GAC|A Chain A, High Resolution Structure Of Mouse Aldehyde Reductase (akr1a4) In Its Apo-form Length = 324 | Back alignment and structure |
| >pdb|3CV7|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Ternary Complex Length = 325 | Back alignment and structure |
| >pdb|1CWN|A Chain A, Crystal Structure Of Porcine Aldehyde Reductase Holoenzyme Length = 324 | Back alignment and structure |
| >pdb|1AE4|A Chain A, Aldehyde Reductase Complexed With Cofactor And Inhibitor, Alpha Carbon Atoms Only Length = 325 | Back alignment and structure |
| >pdb|4F40|A Chain A, X-Ray Crystal Structure Of Apo Prostaglandin F Synthase From Leishmania Major Friedlin Length = 288 | Back alignment and structure |
| >pdb|1MZR|A Chain A, Structure Of Dkga From E.Coli At 2.13 A Resolution Solved By Molecular Replacement Length = 296 | Back alignment and structure |
| >pdb|1HQT|A Chain A, The Crystal Structure Of An Aldehyde Reductase Y50f Mutant- Nadp Complex And Its Implications For Substrate Binding Length = 326 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 234 | |||
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 1e-118 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 1e-115 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 1e-104 | |
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 5e-96 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 2e-92 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 5e-84 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 3e-57 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 1e-55 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 6e-53 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 2e-49 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 4e-47 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 7e-47 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 3e-42 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 7e-17 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 7e-17 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 2e-16 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 3e-16 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 6e-16 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 1e-15 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 1e-15 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 2e-15 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 2e-15 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 2e-15 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 2e-15 | |
| 2ao0_A | 324 | Aldehyde dehydrogenase; TIM barrel, aldo-keto redu | 2e-15 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 3e-15 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 3e-15 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 4e-15 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 4e-15 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 5e-15 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 9e-15 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 2e-14 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 3e-14 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 7e-14 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 2e-13 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 2e-13 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 2e-13 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 2e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 |
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 | Back alignment and structure |
|---|
Score = 337 bits (868), Expect = e-118
Identities = 64/205 (31%), Positives = 110/205 (53%), Gaps = 4/205 (1%)
Query: 11 RVKLGSQGLEVSRLGFGCGGLSG-IYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDH 69
+ KLG L+V +G G + G L+ E G +++E G+T+ DT+ +YG
Sbjct: 3 KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYG-IG 61
Query: 70 DNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYID 129
+E ++G+ L++ R+ + +ATK G SP++++K + SLKRL+ DYID
Sbjct: 62 RSEELIGEVLREFNREDVVIATKAA-HRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYID 120
Query: 130 LYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSL 189
L+Y H D ++ + L ++ + GKI+ IG+S S + ++ A+ + +Q EY+L
Sbjct: 121 LFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNL 180
Query: 190 WTREIEDDIIPLCRFLHI-FLPYNP 213
RE E P + +I F+PY P
Sbjct: 181 LNREAEKTFFPYTKEHNISFIPYFP 205
|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 | Back alignment and structure |
|---|
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Length = 319 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Length = 327 | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Length = 353 | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Length = 327 | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Length = 346 | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 234 | |||
| 3v0s_A | 337 | Perakine reductase; AKR superfamily, oxidoreductas | 100.0 | |
| 1pyf_A | 312 | IOLS protein; beta-alpha barrel, aldo-keto reducta | 100.0 | |
| 3n2t_A | 348 | Putative oxidoreductase; aldo/keto reductase super | 100.0 | |
| 1pz1_A | 333 | GSP69, general stress protein 69; beta-alpha barre | 100.0 | |
| 1ynp_A | 317 | Oxidoreductase, AKR11C1; aldo-keto reductase, NADP | 100.0 | |
| 4exb_A | 292 | Putative uncharacterized protein; aldo-keto reduct | 100.0 | |
| 3eau_A | 327 | Voltage-gated potassium channel subunit beta-2; kv | 100.0 | |
| 3n6q_A | 346 | YGHZ aldo-keto reductase; TIM barrel, oxidoreducta | 100.0 | |
| 1ur3_M | 319 | Hypothetical oxidoreductase YDHF; NADP binding, al | 100.0 | |
| 3erp_A | 353 | Putative oxidoreductase; funded by the national in | 100.0 | |
| 3lut_A | 367 | Voltage-gated potassium channel subunit beta-2; vo | 100.0 | |
| 1lqa_A | 346 | TAS protein; TIM barrel, structure 2 function proj | 100.0 | |
| 3o0k_A | 283 | Aldo/keto reductase; ssgcid, ALS collaborative cry | 100.0 | |
| 2wzm_A | 283 | Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 | 100.0 | |
| 1vbj_A | 281 | Prostaglandin F synthase; TIM barrel, oxidoreducta | 100.0 | |
| 3f7j_A | 276 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 1hw6_A | 278 | 2,5-diketo-D-gluconic acid reductase; aldo-keto re | 100.0 | |
| 3up8_A | 298 | Putative 2,5-diketo-D-gluconic acid reductase B; n | 100.0 | |
| 3ln3_A | 324 | Dihydrodiol dehydrogenase; putative reductase, str | 100.0 | |
| 3b3e_A | 310 | YVGN protein; aldo-keto reductase, oxidoreductase; | 100.0 | |
| 1zgd_A | 312 | Chalcone reductase; polyketide, deoxychalcone, iso | 100.0 | |
| 1mi3_A | 322 | Xylose reductase, XR; aldo-keto reductase, beta-al | 100.0 | |
| 4f40_A | 288 | Prostaglandin F2-alpha synthase/D-arabinose dehyd; | 100.0 | |
| 3buv_A | 326 | 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc | 100.0 | |
| 3o3r_A | 316 | Aldo-keto reductase family 1, member B7; aldose re | 100.0 | |
| 1afs_A | 323 | 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; | 100.0 | |
| 3h7u_A | 335 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 1qwk_A | 317 | Aldose reductase, aldo-keto reductase family 1 mem | 100.0 | |
| 1mzr_A | 296 | 2,5-diketo-D-gluconate reductase A; alpha/beta-bar | 100.0 | |
| 1s1p_A | 331 | Aldo-keto reductase family 1 member C3; TIM-barrel | 100.0 | |
| 4gie_A | 290 | Prostaglandin F synthase; structural genomics, nia | 100.0 | |
| 1us0_A | 316 | Aldose reductase; oxidoreductase, NADP, IDD594; HE | 100.0 | |
| 1vp5_A | 298 | 2,5-diketo-D-gluconic acid reductase; TM1009, stru | 100.0 | |
| 1gve_A | 327 | Aflatoxin B1 aldehyde reductase member 3; oxidored | 100.0 | |
| 2bp1_A | 360 | Aflatoxin B1 aldehyde reductase member 2; oxidored | 100.0 | |
| 3h7r_A | 331 | Aldo-keto reductase; stress response, NADP, drough | 100.0 | |
| 3krb_A | 334 | Aldose reductase; ssgcid, SBRI, emerald biostructu | 100.0 | |
| 2bgs_A | 344 | Aldose reductase; holoenzyme, aldo/keto reductase, | 100.0 | |
| 3b3d_A | 314 | YTBE protein, putative morphine dehydrogenase; ald | 100.0 | |
| 4gac_A | 324 | Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe | 100.0 | |
| 3cf4_A | 807 | Acetyl-COA decarboxylase/synthase alpha subunit; m | 97.82 | |
| 2poz_A | 392 | Putative dehydratase; octamer, structural genomics | 93.06 | |
| 2rdx_A | 379 | Mandelate racemase/muconate lactonizing enzyme, P; | 92.93 | |
| 1mdl_A | 359 | Mandelate racemase; isomerase, mandelate pathway, | 92.77 | |
| 2pgw_A | 384 | Muconate cycloisomerase; enolase superfamily, octa | 91.71 | |
| 2o56_A | 407 | Putative mandelate racemase; dehydratase, structur | 91.57 | |
| 2ovl_A | 371 | Putative racemase; structural genomics, PSI-2, pro | 91.44 | |
| 3i4k_A | 383 | Muconate lactonizing enzyme; structural genomics, | 90.38 | |
| 3eez_A | 378 | Putative mandelate racemase/muconate lactonizing e | 90.35 | |
| 3q45_A | 368 | Mandelate racemase/muconate lactonizing enzyme FA | 90.11 | |
| 2nql_A | 388 | AGR_PAT_674P, isomerase/lactonizing enzyme; enolas | 90.05 | |
| 1nu5_A | 370 | Chloromuconate cycloisomerase; enzyme, dehalogenat | 89.96 | |
| 2zad_A | 345 | Muconate cycloisomerase; muconate lactonizing enzy | 89.46 | |
| 2og9_A | 393 | Mandelate racemase/muconate lactonizing enzyme; NY | 89.38 | |
| 3jva_A | 354 | Dipeptide epimerase; enolase superfamily, isomeras | 89.01 | |
| 1r0m_A | 375 | N-acylamino acid racemase; isomerase; 1.30A {Deino | 88.95 | |
| 3gd6_A | 391 | Muconate cycloisomerase; structural genomics, NYSG | 88.59 | |
| 3ozy_A | 389 | Putative mandelate racemase; beta-alpha barrel, en | 88.55 | |
| 2ox4_A | 403 | Putative mandelate racemase; enolase, dehydratase, | 88.17 | |
| 2ps2_A | 371 | Putative mandelate racemase/muconate lactonizing e | 88.15 | |
| 2qdd_A | 378 | Mandelate racemase/muconate lactonizing enzyme; en | 87.85 | |
| 2qde_A | 397 | Mandelate racemase/muconate lactonizing enzyme FA | 87.72 | |
| 2p8b_A | 369 | Mandelate racemase/muconate lactonizing enzyme fam | 87.69 | |
| 2pp0_A | 398 | L-talarate/galactarate dehydratase; enolase superf | 87.69 | |
| 2qq6_A | 410 | Mandelate racemase/muconate lactonizing enzyme- li | 87.31 | |
| 2gl5_A | 410 | Putative dehydratase protein; structural genomics, | 86.98 | |
| 3dg3_A | 367 | Muconate cycloisomerase; muconate lactonizing enzy | 86.64 | |
| 1tkk_A | 366 | Similar to chloromuconate cycloisomerase; epimeras | 86.61 | |
| 3ik4_A | 365 | Mandelate racemase/muconate lactonizing protein; s | 86.48 | |
| 2qgy_A | 391 | Enolase from the environmental genome shotgun sequ | 86.44 | |
| 1vpq_A | 273 | Hypothetical protein TM1631; structural genomics, | 86.37 | |
| 3fv9_G | 386 | Mandelate racemase/muconate lactonizing enzyme; st | 85.21 | |
| 1rvk_A | 382 | Isomerase/lactonizing enzyme; enolase superfamily, | 84.19 | |
| 2zc8_A | 369 | N-acylamino acid racemase; octamer, TIM beta/alpha | 83.89 | |
| 3i6e_A | 385 | Muconate cycloisomerase I; structural genomics, NY | 83.8 | |
| 3tj4_A | 372 | Mandelate racemase; enolase, dehydratase, enzyme f | 83.59 | |
| 3s5s_A | 389 | Mandelate racemase/muconate lactonizing enzyme FA | 83.22 | |
| 3mwc_A | 400 | Mandelate racemase/muconate lactonizing protein; e | 82.82 | |
| 4dwd_A | 393 | Mandelate racemase/muconate lactonizing enzyme, C | 82.71 | |
| 3r0u_A | 379 | Enzyme of enolase superfamily; structural genomics | 82.33 | |
| 3bjs_A | 428 | Mandelate racemase/muconate lactonizing enzyme; en | 81.7 | |
| 1ydn_A | 295 | Hydroxymethylglutaryl-COA lyase; TIM-barrel protei | 81.68 | |
| 3rr1_A | 405 | GALD, putative D-galactonate dehydratase; enolase, | 81.47 | |
| 3hgj_A | 349 | Chromate reductase; TIM barrel, oxidoreductase; HE | 81.07 | |
| 2hzg_A | 401 | Mandelate racemase/muconate lactonizing enzyme/EN | 81.02 |
| >3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.7e-55 Score=379.05 Aligned_cols=209 Identities=67% Similarity=1.097 Sum_probs=186.3
Q ss_pred CcceecCCCCcccCcceecccccCCCCCCCCCHHHHHHHHHHHHHcCCCEEeCCcCcCCCChhHHHHHHHHhcCCCCceE
Q 026727 9 VPRVKLGSQGLEVSRLGFGCGGLSGIYNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLPRDKIQ 88 (234)
Q Consensus 9 m~~~~lg~~g~~vs~lglG~~~~~~~~~~~~~~~~~~~~l~~A~~~Gin~~DtA~~Yg~~g~sE~~lg~al~~~~R~~~~ 88 (234)
|+|++||+||++||+||||||++|+.|+...+++++.++|++|+++|||+||||+.||.+|.||+.+|++|++.+|+++|
T Consensus 1 M~~~~lg~tg~~vs~lglGt~~~g~~~~~~~~~~~~~~~l~~Al~~Gi~~~DTA~~Yg~~G~sE~~lG~al~~~~R~~~~ 80 (337)
T 3v0s_A 1 MPRVKLGTQGLEVSKLGFGCMGLSGDYNDALPEEQGIAVIKEAFNCGITFFDTSDIYGENGSNEELLGKALKQLPREXIQ 80 (337)
T ss_dssp CCEEECSSSSCEEESSCEECGGGC-------CHHHHHHHHHHHHHTTCCEEECCTTSSSTTHHHHHHHHHHTTSCGGGCE
T ss_pred CCeeecCCCCceecCeeecccccCCCCCCCCCHHHHHHHHHHHHHcCCCEEEChhhhCCCCcHHHHHHHHHhhcCCcceE
Confidence 89999999999999999999999877775558899999999999999999999999996458999999999966899999
Q ss_pred EEeeeccccCCCCCcCCCCCHHHHHHHHHHHHHHcCCCccCeEEEecCCCCCCHHHHHHHHHHHHHcCcccEEecCCCcH
Q 026727 89 LATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASA 168 (234)
Q Consensus 89 i~tK~~~~~~~~~~~~~~~~~~~i~~~~~~sL~~Lg~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvsn~~~ 168 (234)
|+||++......+......+++.+++++++||++||+||||+|++|||+...+++++|++|++|+++|+||+||||||++
T Consensus 81 i~TK~~~~~~~~~~~~~~~~~~~i~~~~~~SL~rLg~dyiDl~~lH~p~~~~~~~e~~~al~~l~~~Gkir~iGvSn~~~ 160 (337)
T 3v0s_A 81 VGTKFGIHEIGFSGVKAXGTPDYVRSCCEASLKRLDVDYIDLFYIHRIDTTVPIEITMGELXXLVEEGKIXYVGLSEASP 160 (337)
T ss_dssp EEEEECEEEEETTEEEECCCHHHHHHHHHHHHHHHTCSCEEEEEESSCCTTSCHHHHHHHHHHHHHTTSEEEEEEESCCH
T ss_pred EEeeeccccCCCCcccCCCCHHHHHHHHHHHHHHhCCCCeeEEEecCCCCCCCHHHHHHHHHHHHHCCCeeEEeccCCCH
Confidence 99999875421122233578999999999999999999999999999999899999999999999999999999999999
Q ss_pred HHHHHHhhcCCeeEEeecCCCCCCCchhcHHHHHHHCCe-EEEeecccCC
Q 026727 169 DTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRFLHI-FLPYNPSFCL 217 (234)
Q Consensus 169 ~~l~~~~~~~~~~~~q~~~n~~~~~~~~~l~~~~~~~gi-v~a~spl~~G 217 (234)
++++++++..+++++|++||+++++.+.+++++|+++|| +++||||++|
T Consensus 161 ~~l~~~~~~~~~~~~Q~~~~~~~~~~e~~l~~~~~~~gi~v~a~spL~~G 210 (337)
T 3v0s_A 161 DTIRRAHAVHPVTALQIEYSLWTRDIEDEIVPLCRQLGIGIVPYSPIGRG 210 (337)
T ss_dssp HHHHHHHHHSCCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEEESTTHHH
T ss_pred HHHHHHhccCCceEEEeeccccccchhHHHHHHHHHcCceEEEeccccCc
Confidence 999999998999999999999999877899999999999 9999999776
|
| >1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* | Back alignment and structure |
|---|
| >3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 | Back alignment and structure |
|---|
| >1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* | Back alignment and structure |
|---|
| >4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A | Back alignment and structure |
|---|
| >3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* | Back alignment and structure |
|---|
| >3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* | Back alignment and structure |
|---|
| >1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* | Back alignment and structure |
|---|
| >3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} | Back alignment and structure |
|---|
| >2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A | Back alignment and structure |
|---|
| >1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* | Back alignment and structure |
|---|
| >1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* | Back alignment and structure |
|---|
| >3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} | Back alignment and structure |
|---|
| >1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* | Back alignment and structure |
|---|
| >4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* | Back alignment and structure |
|---|
| >3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* | Back alignment and structure |
|---|
| >3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* | Back alignment and structure |
|---|
| >1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* | Back alignment and structure |
|---|
| >3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... | Back alignment and structure |
|---|
| >4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* | Back alignment and structure |
|---|
| >1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... | Back alignment and structure |
|---|
| >1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 | Back alignment and structure |
|---|
| >1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* | Back alignment and structure |
|---|
| >3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} | Back alignment and structure |
|---|
| >2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* | Back alignment and structure |
|---|
| >3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* | Back alignment and structure |
|---|
| >3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} | Back alignment and structure |
|---|
| >1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A | Back alignment and structure |
|---|
| >2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A | Back alignment and structure |
|---|
| >3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A | Back alignment and structure |
|---|
| >2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A | Back alignment and structure |
|---|
| >1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 | Back alignment and structure |
|---|
| >2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A | Back alignment and structure |
|---|
| >2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* | Back alignment and structure |
|---|
| >3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* | Back alignment and structure |
|---|
| >1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A | Back alignment and structure |
|---|
| >3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* | Back alignment and structure |
|---|
| >3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* | Back alignment and structure |
|---|
| >2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} | Back alignment and structure |
|---|
| >2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} | Back alignment and structure |
|---|
| >2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B | Back alignment and structure |
|---|
| >2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} | Back alignment and structure |
|---|
| >2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* | Back alignment and structure |
|---|
| >2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* | Back alignment and structure |
|---|
| >2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} | Back alignment and structure |
|---|
| >2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* | Back alignment and structure |
|---|
| >3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* | Back alignment and structure |
|---|
| >1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A | Back alignment and structure |
|---|
| >3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} | Back alignment and structure |
|---|
| >2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} | Back alignment and structure |
|---|
| >1vpq_A Hypothetical protein TM1631; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.1.32.1 | Back alignment and structure |
|---|
| >3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A | Back alignment and structure |
|---|
| >1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 | Back alignment and structure |
|---|
| >2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A | Back alignment and structure |
|---|
| >3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* | Back alignment and structure |
|---|
| >3s5s_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium; 2.40A {Sorangium cellulosum} | Back alignment and structure |
|---|
| >3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} | Back alignment and structure |
|---|
| >4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* | Back alignment and structure |
|---|
| >3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* | Back alignment and structure |
|---|
| >3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} | Back alignment and structure |
|---|
| >3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A | Back alignment and structure |
|---|
| >3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* | Back alignment and structure |
|---|
| >2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 234 | ||||
| d1pyfa_ | 311 | c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu | 3e-36 | |
| d1lqaa_ | 346 | c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: | 6e-34 | |
| d1pz1a_ | 333 | c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu | 6e-28 | |
| d3eaua1 | 326 | c.1.7.1 (A:36-361) Voltage-dependent K+ channel be | 1e-27 | |
| d1s1pa_ | 315 | c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak | 3e-26 | |
| d1us0a_ | 314 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 3e-25 | |
| d1mi3a_ | 319 | c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu | 9e-25 | |
| d1vp5a_ | 284 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 9e-25 | |
| d1qwka_ | 312 | c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod | 2e-24 | |
| d1hqta_ | 324 | c.1.7.1 (A:) Aldose reductase (aldehyde reductase) | 7e-24 | |
| d1afsa_ | 319 | c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase | 2e-23 | |
| d1mzra_ | 274 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 8e-22 | |
| d1ur3m_ | 298 | c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc | 4e-21 | |
| d1frba_ | 315 | c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce | 5e-19 | |
| d1hw6a_ | 262 | c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase | 2e-16 | |
| d1gvea_ | 324 | c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) | 2e-15 |
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Putative oxidoreductase IolS species: Bacillus subtilis [TaxId: 1423]
Score = 128 bits (321), Expect = 3e-36
Identities = 65/208 (31%), Positives = 111/208 (53%), Gaps = 4/208 (1%)
Query: 11 RVKLGSQGLEVSRLGFGCGGLSGIYNKP-LSHEVGCSIIKETFNRGITLFDTSDVYGVDH 69
+ KLG L+V +G G + G P L+ E G +++E G+T+ DT+ +YG
Sbjct: 2 KAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYG-IG 60
Query: 70 DNEIMVGKALKQLPRDKIQLATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYID 129
+E ++G+ L++ R+ + +ATK G SP++++K + SLKRL+ DYID
Sbjct: 61 RSEELIGEVLREFNREDVVIATKAAHRK-QGNDFVFDNSPDFLKKSVDESLKRLNTDYID 119
Query: 130 LYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASADTIRRAHAVHPITAVQMEYSL 189
L+Y H D ++ + L ++ + GKI+ IG+S S + ++ A+ + +Q EY+L
Sbjct: 120 LFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNL 179
Query: 190 WTREIEDDIIPLCRFLHI-FLPYNPSFC 216
RE E P + +I F+PY P
Sbjct: 180 LNREAEKTFFPYTKEHNISFIPYFPLVS 207
|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 | Back information, alignment and structure |
|---|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 234 | |||
| d1pyfa_ | 311 | Putative oxidoreductase IolS {Bacillus subtilis [T | 100.0 | |
| d1pz1a_ | 333 | Putative oxidoreductase YhdN {Bacillus subtilis [T | 100.0 | |
| d1ur3m_ | 298 | Hypothetical oxidoreductase YdhF {Escherichia coli | 100.0 | |
| d1gvea_ | 324 | Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus | 100.0 | |
| d1lqaa_ | 346 | Tas protein {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1hw6a_ | 262 | 2,5-diketo-D-gluconic acid reductase A {Corynebact | 100.0 | |
| d3eaua1 | 326 | Voltage-dependent K+ channel beta subunit {Rat (Ra | 100.0 | |
| d1qwka_ | 312 | Hypothetical protein C07D8.6 {Nematode (Caenorhabd | 100.0 | |
| d1s1pa_ | 315 | Prostaglandin d2 11-ketoreductase (akr1c3) {Human | 100.0 | |
| d1afsa_ | 319 | 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus | 100.0 | |
| d1us0a_ | 314 | Aldose reductase (aldehyde reductase) {Human (Homo | 100.0 | |
| d1mi3a_ | 319 | Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 | 100.0 | |
| d1mzra_ | 274 | 2,5-diketo-D-gluconic acid reductase A {Escherichi | 100.0 | |
| d1vp5a_ | 284 | 2,5-diketo-D-gluconic acid reductase A {Thermotoga | 100.0 | |
| d1hqta_ | 324 | Aldose reductase (aldehyde reductase) {Pig (Sus sc | 100.0 | |
| d1frba_ | 315 | FR-1 (fibroblast growth factor-induced) protein {M | 100.0 | |
| d1sjda1 | 242 | N-acylamino acid racemase {Amycolatopsis sp. [TaxI | 89.41 | |
| d1jpma1 | 234 | L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: | 89.15 | |
| d1kcza1 | 253 | beta-Methylaspartase {Clostridium tetanomorphum [T | 87.93 | |
| d2chra1 | 244 | Chlormuconate cycloisomerase {Alcaligenes eutrophu | 85.49 | |
| d1kkoa1 | 251 | beta-Methylaspartase {Citrobacter amalonaticus [Ta | 84.57 | |
| d1r0ma1 | 243 | N-acylamino acid racemase {Deinococcus radiodurans | 84.49 | |
| d1yeya1 | 252 | RTS beta protein {Xanthomonas campestris pv. campe | 83.64 | |
| d1nu5a1 | 243 | Chlormuconate cycloisomerase {Pseudomonas sp. p51 | 80.26 |
| >d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: NAD(P)-linked oxidoreductase family: Aldo-keto reductases (NADP) domain: Putative oxidoreductase IolS species: Bacillus subtilis [TaxId: 1423]
Probab=100.00 E-value=1.5e-48 Score=331.62 Aligned_cols=207 Identities=30% Similarity=0.563 Sum_probs=189.5
Q ss_pred cceecCCCCcccCcceecccccCCC-CCCCCCHHHHHHHHHHHHHcCCCEEeCCcCcCCCChhHHHHHHHHhcCCCCceE
Q 026727 10 PRVKLGSQGLEVSRLGFGCGGLSGI-YNKPLSHEVGCSIIKETFNRGITLFDTSDVYGVDHDNEIMVGKALKQLPRDKIQ 88 (234)
Q Consensus 10 ~~~~lg~~g~~vs~lglG~~~~~~~-~~~~~~~~~~~~~l~~A~~~Gin~~DtA~~Yg~~g~sE~~lg~al~~~~R~~~~ 88 (234)
++|+||+||++||+||||||++|+. +....+++++.++|++|+++|||+||||+.||+ |.+|+.+|++|+..+|++++
T Consensus 1 ~~~rLG~tgl~vS~iglGt~~~g~~~~~~~~~~~~a~~~l~~A~~~Gin~~DTA~~Yg~-g~sE~~lg~~l~~~~r~~~~ 79 (311)
T d1pyfa_ 1 KKAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGI-GRSEELIGEVLREFNREDVV 79 (311)
T ss_dssp CCEECTTSCCEECSBCEECTTSSCTTTCSSCCHHHHHHHHHHHHHTTCCEEECCTTTTT-THHHHHHHHHHTTSCGGGCE
T ss_pred CCcccCCCCCeecceeeeCcccCCCCCCCCCCHHHHHHHHHHHHHcCCCEEEehhhcCC-CccHHHHhhhhhccccccee
Confidence 5899999999999999999999863 233458899999999999999999999999998 99999999999988899999
Q ss_pred EEeeeccccCCCCCcCCCCCHHHHHHHHHHHHHHcCCCccCeEEEecCCCCCCHHHHHHHHHHHHHcCcccEEecCCCcH
Q 026727 89 LATKFGCFMLDGVSIGVKGSPEYVRKCCEASLKRLDVDYIDLYYQHRVDTSVSIEDTMGELKKLVEEGKIKYIGLSEASA 168 (234)
Q Consensus 89 i~tK~~~~~~~~~~~~~~~~~~~i~~~~~~sL~~Lg~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~G~ir~iGvsn~~~ 168 (234)
|+||++..... .....+.+++.+++++++||++|++||+|++++|+|+...+.++++++|++|+++|+|++|||||+++
T Consensus 80 i~tK~~~~~~~-~~~~~~~~~~~i~~s~~~SL~rl~~d~iDl~~lh~~~~~~~~~~~~~~l~~l~~~Gkir~iGvs~~~~ 158 (311)
T d1pyfa_ 80 IATKAAHRKQG-NDFVFDNSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSL 158 (311)
T ss_dssp EEEEECEEEET-TEEEECCCHHHHHHHHHHHHHHHTSSCBSEEEECSCCSSSCHHHHHHHHHHHHHTTSBSCEEEESCCH
T ss_pred cceeccCCCCC-cccccccchHHHHHHHHhhHHhhCCcHHhhhcccCCCcccchhhHHHHHHHHHhCCeEEeecccCCcH
Confidence 99999865432 12244578999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhhcCCeeEEeecCCCCCCCchhcHHHHHHHCCe-EEEeecccCCc
Q 026727 169 DTIRRAHAVHPITAVQMEYSLWTREIEDDIIPLCRFLHI-FLPYNPSFCLQ 218 (234)
Q Consensus 169 ~~l~~~~~~~~~~~~q~~~n~~~~~~~~~l~~~~~~~gi-v~a~spl~~G~ 218 (234)
+.+.++.+..+++++|++||++++..+.+++++|+++|| +++|+||++|-
T Consensus 159 ~~~~~~~~~~~~~~~q~~~n~~~~~~~~~~~~~~~~~~i~v~~~~~l~~G~ 209 (311)
T d1pyfa_ 159 EQLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGL 209 (311)
T ss_dssp HHHHHHTTTSCCCEEEEECBTTBCGGGTTHHHHHHHHTCEEEEESTTTTTG
T ss_pred HHHHHHhhcCCcceEeeeecccchhhhHHHHHHHHHCCceEEEeccccCCc
Confidence 999999998999999999999999877899999999999 99999997774
|
| >d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} | Back information, alignment and structure |
|---|
| >d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} | Back information, alignment and structure |
|---|
| >d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sjda1 c.1.11.2 (A:126-367) N-acylamino acid racemase {Amycolatopsis sp. [TaxId: 37632]} | Back information, alignment and structure |
|---|
| >d1jpma1 c.1.11.2 (A:126-359) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kcza1 c.1.11.2 (A:161-413) beta-Methylaspartase {Clostridium tetanomorphum [TaxId: 1553]} | Back information, alignment and structure |
|---|
| >d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1kkoa1 c.1.11.2 (A:161-411) beta-Methylaspartase {Citrobacter amalonaticus [TaxId: 35703]} | Back information, alignment and structure |
|---|
| >d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} | Back information, alignment and structure |
|---|
| >d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} | Back information, alignment and structure |
|---|