Citrus Sinensis ID: 026748
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 234 | ||||||
| 225438676 | 350 | PREDICTED: methionine aminopeptidase 1D, | 0.970 | 0.648 | 0.821 | 1e-104 | |
| 224081610 | 350 | predicted protein [Populus trichocarpa] | 0.970 | 0.648 | 0.8 | 1e-103 | |
| 255637733 | 260 | unknown [Glycine max] | 0.978 | 0.880 | 0.786 | 1e-100 | |
| 356496878 | 356 | PREDICTED: methionine aminopeptidase 1D, | 0.978 | 0.643 | 0.786 | 1e-100 | |
| 255565134 | 282 | methionine aminopeptidase, putative [Ric | 0.970 | 0.804 | 0.773 | 2e-99 | |
| 449460600 | 352 | PREDICTED: methionine aminopeptidase 1D, | 0.931 | 0.619 | 0.780 | 4e-96 | |
| 297798178 | 350 | hypothetical protein ARALYDRAFT_912645 [ | 0.944 | 0.631 | 0.773 | 5e-96 | |
| 18419957 | 350 | methionine aminopeptidase 1D [Arabidopsi | 0.944 | 0.631 | 0.764 | 4e-94 | |
| 357482963 | 351 | Methionine aminopeptidase [Medicago trun | 0.901 | 0.601 | 0.762 | 2e-89 | |
| 219362739 | 370 | methionine aminopeptidase [Zea mays] gi| | 0.893 | 0.564 | 0.727 | 5e-82 |
| >gi|225438676|ref|XP_002282060.1| PREDICTED: methionine aminopeptidase 1D, chloroplastic/mitochondrial [Vitis vinifera] gi|296082435|emb|CBI21440.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 382 bits (982), Expect = e-104, Method: Compositional matrix adjust.
Identities = 189/230 (82%), Positives = 202/230 (87%), Gaps = 3/230 (1%)
Query: 1 MVGGACSLQLQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFN 60
MVG + LQPRLLSSFVG+RF+ S +PL+QLF N G VSMQLSRTFSGL +LLFN
Sbjct: 1 MVGAS---SLQPRLLSSFVGDRFVQSQRPLHQLFRCNPGNKHVSMQLSRTFSGLTNLLFN 57
Query: 61 RRNLDAEPNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMR 120
RRNL+ PN +RKRLRPGK+SP RPVP HI RP YV S+KP GIVSGPEVHDEKGIECMR
Sbjct: 58 RRNLEGLPNSKRKRLRPGKLSPCRPVPGHILRPSYVTSKKPPGIVSGPEVHDEKGIECMR 117
Query: 121 VSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNEC 180
SGRLAAQVLEYAGTLVKPGI TDEID+AVHQMIIDNGAYPSPLGYGGFPKSVCTSVNEC
Sbjct: 118 NSGRLAAQVLEYAGTLVKPGIKTDEIDEAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNEC 177
Query: 181 ICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVK 230
ICHGIPDSR LEDGD INIDVTVYLNGYHGDTSATFFCGDVDD+AR LV+
Sbjct: 178 ICHGIPDSRPLEDGDIINIDVTVYLNGYHGDTSATFFCGDVDDKARKLVE 227
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224081610|ref|XP_002306464.1| predicted protein [Populus trichocarpa] gi|222855913|gb|EEE93460.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255637733|gb|ACU19189.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356496878|ref|XP_003517292.1| PREDICTED: methionine aminopeptidase 1D, chloroplastic/mitochondrial-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255565134|ref|XP_002523559.1| methionine aminopeptidase, putative [Ricinus communis] gi|223537121|gb|EEF38754.1| methionine aminopeptidase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449460600|ref|XP_004148033.1| PREDICTED: methionine aminopeptidase 1D, chloroplastic/mitochondrial-like [Cucumis sativus] gi|449502729|ref|XP_004161726.1| PREDICTED: methionine aminopeptidase 1D, chloroplastic/mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297798178|ref|XP_002866973.1| hypothetical protein ARALYDRAFT_912645 [Arabidopsis lyrata subsp. lyrata] gi|297312809|gb|EFH43232.1| hypothetical protein ARALYDRAFT_912645 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18419957|ref|NP_568014.1| methionine aminopeptidase 1D [Arabidopsis thaliana] gi|75172582|sp|Q9FV50.1|AMP1D_ARATH RecName: Full=Methionine aminopeptidase 1D, chloroplastic/mitochondrial; Short=MAP 1D; Short=MetAP 1D; AltName: Full=Peptidase M 1D; Flags: Precursor gi|11320960|gb|AAG33977.1|AF250963_1 methionine aminopeptidase-like protein [Arabidopsis thaliana] gi|21553973|gb|AAM63054.1| methionyl aminopeptidase-like protein [Arabidopsis thaliana] gi|26451668|dbj|BAC42930.1| putative ap2 methionine aminopeptidase [Arabidopsis thaliana] gi|28973551|gb|AAO64100.1| putative methionyl aminopeptidase [Arabidopsis thaliana] gi|332661340|gb|AEE86740.1| methionine aminopeptidase 1D [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357482963|ref|XP_003611768.1| Methionine aminopeptidase [Medicago truncatula] gi|355513103|gb|AES94726.1| Methionine aminopeptidase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|219362739|ref|NP_001136774.1| methionine aminopeptidase [Zea mays] gi|194697010|gb|ACF82589.1| unknown [Zea mays] gi|413939016|gb|AFW73567.1| methionine aminopeptidase [Zea mays] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 234 | ||||||
| TAIR|locus:2115125 | 350 | MAP1D "methionine aminopeptida | 0.944 | 0.631 | 0.764 | 1.7e-89 | |
| TAIR|locus:2205329 | 369 | MAP1C "methionine aminopeptida | 0.782 | 0.495 | 0.629 | 2e-56 | |
| TAIR|locus:2085979 | 344 | MAP1B "methionine aminopeptida | 0.653 | 0.444 | 0.666 | 1.3e-50 | |
| DICTYBASE|DDB_G0280127 | 404 | map1d "methionine aminopeptida | 0.726 | 0.420 | 0.572 | 1.4e-48 | |
| UNIPROTKB|P0A5J2 | 285 | map "Methionine aminopeptidase | 0.666 | 0.547 | 0.591 | 3.9e-44 | |
| ZFIN|ZDB-GENE-050522-71 | 338 | metap1d "methionyl aminopeptid | 0.730 | 0.505 | 0.543 | 3.5e-43 | |
| RGD|1307413 | 334 | Metap1d "methionyl aminopeptid | 0.641 | 0.449 | 0.588 | 1.1e-41 | |
| UNIPROTKB|F1P5C7 | 320 | METAP1D "Methionine aminopepti | 0.641 | 0.468 | 0.582 | 1.7e-41 | |
| FB|FBgn0032247 | 317 | CG5188 [Drosophila melanogaste | 0.739 | 0.545 | 0.494 | 3.6e-41 | |
| UNIPROTKB|F1PFF1 | 451 | METAP1D "Methionine aminopepti | 0.641 | 0.332 | 0.582 | 5.9e-41 |
| TAIR|locus:2115125 MAP1D "methionine aminopeptidase 1D" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 893 (319.4 bits), Expect = 1.7e-89, P = 1.7e-89
Identities = 169/221 (76%), Positives = 190/221 (85%)
Query: 10 LQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFNRRNLDAEPN 69
LQPRL+SSF+GN I STQPL LF ++ G+ VSMQLSRTFSGL DLLFNRRN D +
Sbjct: 7 LQPRLISSFLGNNSIRSTQPLIHLFRFDLGRRHVSMQLSRTFSGLTDLLFNRRNEDEVID 66
Query: 70 RRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMRVSGRLAAQV 129
+RKRLRPG VSP RPVP HI +PPYV+S + GI SG EVHD+KGIECMR SG LAA+V
Sbjct: 67 GKRKRLRPGNVSPRRPVPGHITKPPYVDSLQAPGISSGLEVHDKKGIECMRASGILAARV 126
Query: 130 LEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSR 189
+YAGTLVKPG+TTDEID+AVH MII+NGAYPSPLGYGGFPKSVCTSVNECICHGIPDSR
Sbjct: 127 RDYAGTLVKPGVTTDEIDEAVHNMIIENGAYPSPLGYGGFPKSVCTSVNECICHGIPDSR 186
Query: 190 ALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVK 230
LEDGD INIDVTVYLNGYHGDTSATFFCG+VD++A+ LV+
Sbjct: 187 PLEDGDIINIDVTVYLNGYHGDTSATFFCGNVDEKAKKLVE 227
|
|
| TAIR|locus:2205329 MAP1C "methionine aminopeptidase 1B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085979 MAP1B "methionine aminopeptidase 1C" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0280127 map1d "methionine aminopeptidase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P0A5J2 map "Methionine aminopeptidase 2" [Mycobacterium tuberculosis (taxid:1773)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050522-71 metap1d "methionyl aminopeptidase type 1D (mitochondrial)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1307413 Metap1d "methionyl aminopeptidase type 1D (mitochondrial)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P5C7 METAP1D "Methionine aminopeptidase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032247 CG5188 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PFF1 METAP1D "Methionine aminopeptidase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_V000509 | hypothetical protein; Removes the amino-terminal methionine from nascent proteins (By similarity) (350 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.IV.3048.1 | • | • | • | 0.848 | |||||||
| eugene3.00141000 | • | • | • | 0.806 | |||||||
| gw1.VI.8.1 | • | • | 0.804 | ||||||||
| rps8 | • | • | • | 0.793 | |||||||
| gw1.16155.2.1 | • | • | • | 0.792 | |||||||
| gw1.XVIII.2978.1 | • | • | 0.739 | ||||||||
| gw1.II.2942.1 | • | • | • | 0.734 | |||||||
| estExt_Genewise1_v1.C_LG_X3691 | • | • | • | 0.722 | |||||||
| estExt_fgenesh4_pg.C_13160002 | • | • | • | 0.711 | |||||||
| gw1.VI.1738.1 | • | • | • | 0.709 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 234 | |||
| cd01086 | 238 | cd01086, MetAP1, Methionine Aminopeptidase 1 | 4e-67 | |
| PRK05716 | 252 | PRK05716, PRK05716, methionine aminopeptidase; Val | 1e-63 | |
| PLN03158 | 396 | PLN03158, PLN03158, methionine aminopeptidase; Pro | 4e-60 | |
| PRK12896 | 255 | PRK12896, PRK12896, methionine aminopeptidase; Rev | 2e-58 | |
| COG0024 | 255 | COG0024, Map, Methionine aminopeptidase [Translati | 8e-53 | |
| TIGR00500 | 247 | TIGR00500, met_pdase_I, methionine aminopeptidase, | 7e-49 | |
| pfam00557 | 208 | pfam00557, Peptidase_M24, Metallopeptidase family | 1e-33 | |
| PRK12318 | 291 | PRK12318, PRK12318, methionine aminopeptidase; Pro | 3e-31 | |
| PRK12897 | 248 | PRK12897, PRK12897, methionine aminopeptidase; Rev | 2e-24 | |
| cd01066 | 207 | cd01066, APP_MetAP, A family including aminopeptid | 3e-24 | |
| COG0006 | 384 | COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid | 2e-20 | |
| cd01092 | 208 | cd01092, APP-like, Similar to Prolidase and Aminop | 5e-17 | |
| PRK08671 | 291 | PRK08671, PRK08671, methionine aminopeptidase; Pro | 1e-14 | |
| cd01088 | 291 | cd01088, MetAP2, Methionine Aminopeptidase 2 | 6e-14 | |
| TIGR00501 | 295 | TIGR00501, met_pdase_II, methionine aminopeptidase | 8e-12 | |
| PRK07281 | 286 | PRK07281, PRK07281, methionine aminopeptidase; Rev | 4e-06 | |
| cd01089 | 228 | cd01089, PA2G4-like, Related to aminopepdidase M, | 1e-05 | |
| PRK10879 | 438 | PRK10879, PRK10879, proline aminopeptidase P II; P | 2e-05 | |
| PTZ00053 | 470 | PTZ00053, PTZ00053, methionine aminopeptidase 2; P | 3e-05 | |
| cd01066 | 207 | cd01066, APP_MetAP, A family including aminopeptid | 2e-04 | |
| TIGR00495 | 389 | TIGR00495, crvDNA_42K, 42K curved DNA binding prot | 2e-04 | |
| cd01087 | 243 | cd01087, Prolidase, Prolidase | 0.001 |
| >gnl|CDD|238519 cd01086, MetAP1, Methionine Aminopeptidase 1 | Back alignment and domain information |
|---|
Score = 206 bits (527), Expect = 4e-67
Identities = 67/115 (58%), Positives = 90/115 (78%)
Query: 116 IECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCT 175
IE MR +GR+ A+VL+ +KPG+TT E+D+ H+ I ++GAYP+PLGY GFPKS+CT
Sbjct: 1 IEGMREAGRIVAEVLDELAKAIKPGVTTKELDQIAHEFIEEHGAYPAPLGYYGFPKSICT 60
Query: 176 SVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVK 230
SVNE +CHGIPD R L+DGD +NIDV V L+GYHGD++ TF G+V +EA+ LV+
Sbjct: 61 SVNEVVCHGIPDDRVLKDGDIVNIDVGVELDGYHGDSARTFIVGEVSEEAKKLVE 115
|
E.C. 3.4.11.18. Also known as methionyl aminopeptidase and Peptidase M. Catalyzes release of N-terminal amino acids, preferentially methionine, from peptides and arylamides. Length = 238 |
| >gnl|CDD|235576 PRK05716, PRK05716, methionine aminopeptidase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|215607 PLN03158, PLN03158, methionine aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237252 PRK12896, PRK12896, methionine aminopeptidase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223103 COG0024, Map, Methionine aminopeptidase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|129591 TIGR00500, met_pdase_I, methionine aminopeptidase, type I | Back alignment and domain information |
|---|
| >gnl|CDD|215993 pfam00557, Peptidase_M24, Metallopeptidase family M24 | Back alignment and domain information |
|---|
| >gnl|CDD|183434 PRK12318, PRK12318, methionine aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171806 PRK12897, PRK12897, methionine aminopeptidase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238514 cd01066, APP_MetAP, A family including aminopeptidase P, aminopeptidase M, and prolidase | Back alignment and domain information |
|---|
| >gnl|CDD|223085 COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238525 cd01092, APP-like, Similar to Prolidase and Aminopeptidase P | Back alignment and domain information |
|---|
| >gnl|CDD|181534 PRK08671, PRK08671, methionine aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238521 cd01088, MetAP2, Methionine Aminopeptidase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|129592 TIGR00501, met_pdase_II, methionine aminopeptidase, type II | Back alignment and domain information |
|---|
| >gnl|CDD|180918 PRK07281, PRK07281, methionine aminopeptidase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238522 cd01089, PA2G4-like, Related to aminopepdidase M, this family contains proliferation-associated protein 2G4 | Back alignment and domain information |
|---|
| >gnl|CDD|182804 PRK10879, PRK10879, proline aminopeptidase P II; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238514 cd01066, APP_MetAP, A family including aminopeptidase P, aminopeptidase M, and prolidase | Back alignment and domain information |
|---|
| >gnl|CDD|129586 TIGR00495, crvDNA_42K, 42K curved DNA binding protein | Back alignment and domain information |
|---|
| >gnl|CDD|238520 cd01087, Prolidase, Prolidase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 234 | |||
| KOG2738 | 369 | consensus Putative methionine aminopeptidase [Post | 100.0 | |
| PLN03158 | 396 | methionine aminopeptidase; Provisional | 100.0 | |
| COG0024 | 255 | Map Methionine aminopeptidase [Translation, riboso | 99.97 | |
| PRK12897 | 248 | methionine aminopeptidase; Reviewed | 99.97 | |
| PRK12318 | 291 | methionine aminopeptidase; Provisional | 99.96 | |
| PRK07281 | 286 | methionine aminopeptidase; Reviewed | 99.96 | |
| TIGR00500 | 247 | met_pdase_I methionine aminopeptidase, type I. Met | 99.96 | |
| PRK12896 | 255 | methionine aminopeptidase; Reviewed | 99.96 | |
| PRK05716 | 252 | methionine aminopeptidase; Validated | 99.95 | |
| COG0006 | 384 | PepP Xaa-Pro aminopeptidase [Amino acid transport | 99.95 | |
| PRK10879 | 438 | proline aminopeptidase P II; Provisional | 99.94 | |
| PRK09795 | 361 | aminopeptidase; Provisional | 99.94 | |
| TIGR02993 | 391 | ectoine_eutD ectoine utilization protein EutD. Mem | 99.93 | |
| PRK15173 | 323 | peptidase; Provisional | 99.92 | |
| cd01090 | 228 | Creatinase Creatine amidinohydrolase. E.C.3.5.3.3. | 99.92 | |
| PRK14575 | 406 | putative peptidase; Provisional | 99.92 | |
| cd01086 | 238 | MetAP1 Methionine Aminopeptidase 1. E.C. 3.4.11.18 | 99.92 | |
| cd01087 | 243 | Prolidase Prolidase. E.C. 3.4.13.9. Also known as | 99.92 | |
| PRK14576 | 405 | putative endopeptidase; Provisional | 99.91 | |
| PRK13607 | 443 | proline dipeptidase; Provisional | 99.91 | |
| cd01092 | 208 | APP-like Similar to Prolidase and Aminopeptidase P | 99.9 | |
| TIGR00495 | 389 | crvDNA_42K 42K curved DNA binding protein. Protein | 99.9 | |
| cd01085 | 224 | APP X-Prolyl Aminopeptidase 2. E.C. 3.4.11.9. Also | 99.89 | |
| PF00557 | 207 | Peptidase_M24: Metallopeptidase family M24 This Pr | 99.88 | |
| cd01089 | 228 | PA2G4-like Related to aminopepdidase M, this famil | 99.87 | |
| PTZ00053 | 470 | methionine aminopeptidase 2; Provisional | 99.87 | |
| cd01066 | 207 | APP_MetAP A family including aminopeptidase P, ami | 99.87 | |
| TIGR00501 | 295 | met_pdase_II methionine aminopeptidase, type II. M | 99.85 | |
| PRK08671 | 291 | methionine aminopeptidase; Provisional | 99.84 | |
| cd01088 | 291 | MetAP2 Methionine Aminopeptidase 2. E.C. 3.4.11.18 | 99.81 | |
| KOG2414 | 488 | consensus Putative Xaa-Pro aminopeptidase [Amino a | 99.81 | |
| KOG2737 | 492 | consensus Putative metallopeptidase [General funct | 99.81 | |
| cd01091 | 243 | CDC68-like Related to aminopeptidase P and aminope | 99.76 | |
| KOG2776 | 398 | consensus Metallopeptidase [General function predi | 99.27 | |
| KOG2413 | 606 | consensus Xaa-Pro aminopeptidase [Amino acid trans | 99.21 | |
| KOG1189 | 960 | consensus Global transcriptional regulator, cell d | 98.89 | |
| KOG2775 | 397 | consensus Metallopeptidase [General function predi | 98.77 | |
| COG5406 | 1001 | Nucleosome binding factor SPN, SPT16 subunit [Tran | 98.17 | |
| cd01066 | 207 | APP_MetAP A family including aminopeptidase P, ami | 97.9 | |
| cd01092 | 208 | APP-like Similar to Prolidase and Aminopeptidase P | 97.71 | |
| PRK05716 | 252 | methionine aminopeptidase; Validated | 97.54 | |
| cd01086 | 238 | MetAP1 Methionine Aminopeptidase 1. E.C. 3.4.11.18 | 97.47 | |
| PRK15173 | 323 | peptidase; Provisional | 97.46 | |
| TIGR00500 | 247 | met_pdase_I methionine aminopeptidase, type I. Met | 97.45 | |
| PRK14575 | 406 | putative peptidase; Provisional | 97.39 | |
| cd01090 | 228 | Creatinase Creatine amidinohydrolase. E.C.3.5.3.3. | 97.37 | |
| PRK09795 | 361 | aminopeptidase; Provisional | 97.36 | |
| PRK08671 | 291 | methionine aminopeptidase; Provisional | 97.33 | |
| PRK14576 | 405 | putative endopeptidase; Provisional | 97.3 | |
| TIGR02993 | 391 | ectoine_eutD ectoine utilization protein EutD. Mem | 97.28 | |
| cd01088 | 291 | MetAP2 Methionine Aminopeptidase 2. E.C. 3.4.11.18 | 97.28 | |
| PRK12897 | 248 | methionine aminopeptidase; Reviewed | 97.25 | |
| PRK12318 | 291 | methionine aminopeptidase; Provisional | 97.19 | |
| PF00557 | 207 | Peptidase_M24: Metallopeptidase family M24 This Pr | 97.18 | |
| cd01091 | 243 | CDC68-like Related to aminopeptidase P and aminope | 97.11 | |
| PRK12896 | 255 | methionine aminopeptidase; Reviewed | 97.07 | |
| cd01087 | 243 | Prolidase Prolidase. E.C. 3.4.13.9. Also known as | 97.04 | |
| PRK07281 | 286 | methionine aminopeptidase; Reviewed | 97.0 | |
| cd01089 | 228 | PA2G4-like Related to aminopepdidase M, this famil | 96.9 | |
| TIGR00501 | 295 | met_pdase_II methionine aminopeptidase, type II. M | 96.86 | |
| PLN03158 | 396 | methionine aminopeptidase; Provisional | 96.7 | |
| COG0006 | 384 | PepP Xaa-Pro aminopeptidase [Amino acid transport | 96.62 | |
| TIGR00495 | 389 | crvDNA_42K 42K curved DNA binding protein. Protein | 96.38 | |
| PTZ00053 | 470 | methionine aminopeptidase 2; Provisional | 96.35 | |
| COG0024 | 255 | Map Methionine aminopeptidase [Translation, riboso | 96.03 | |
| PRK10879 | 438 | proline aminopeptidase P II; Provisional | 95.99 | |
| cd01085 | 224 | APP X-Prolyl Aminopeptidase 2. E.C. 3.4.11.9. Also | 95.03 | |
| PRK13607 | 443 | proline dipeptidase; Provisional | 94.49 | |
| KOG2738 | 369 | consensus Putative methionine aminopeptidase [Post | 87.17 | |
| KOG1189 | 960 | consensus Global transcriptional regulator, cell d | 86.89 |
| >KOG2738 consensus Putative methionine aminopeptidase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.8e-51 Score=363.55 Aligned_cols=167 Identities=65% Similarity=1.054 Sum_probs=158.8
Q ss_pred CCCCccCCCcccCCCCCCCCCCCCCCCCccCCCC----CCCCC-CCccCCHHHHHHHHHHHHHHHHHHHHHhhhcCCCCC
Q 026748 68 PNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKP----IGIVS-GPEVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGIT 142 (234)
Q Consensus 68 ~~~~~~~l~~g~~s~~~~vp~~i~~p~y~~~~~~----~~~~~-~R~VKs~eEIe~mR~Aa~ia~~al~~~~~~ikpGvT 142 (234)
.|.++++||||++||+|.||+||+||+|+.+|.+ +.+.. ...|++++||++||+||++++++++++..+++||+|
T Consensus 69 ~~~~~g~Lr~~pvsprr~VP~hI~rPdya~~g~s~se~~~~~s~~i~i~~~e~ie~mR~ac~LarevLd~Aa~~v~PgvT 148 (369)
T KOG2738|consen 69 KFRFTGPLRPGPVSPRRPVPDHIPRPDYADSGVSLSEQPEISSNEIKILDPEGIEGMRKACRLAREVLDYAATLVRPGVT 148 (369)
T ss_pred cccccCCccccCCCCCCcCCccCCCCchhhcCCcccccccccccceeccCHHHHHHHHHHHHHHHHHHHHHhhhcCCCcc
Confidence 4899999999999999999999999999999764 22322 467899999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHCCCCCCCCCCCCCCCeeeecCCCceeccCCCCCCCCCCCEEEEEEeeEECCEEeceeeEEEcCCCC
Q 026748 143 TDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVD 222 (234)
Q Consensus 143 e~EI~~~v~~~l~~~Ga~ps~l~y~gFp~~v~sg~N~~~~Hg~P~~r~L~~GDiV~iDvg~~~~GY~~D~sRTf~VG~~s 222 (234)
++|||+++|++++++|+|||||||.+||+++|+|+|+++|||+|+.|+||+|||||||++++++|||+|+++||+||+++
T Consensus 149 TdEiD~~VH~a~Ierg~YPSPLnYy~FPKS~CTSVNEviCHGIPD~RpLedGDIvNiDVtvY~~GyHGDlneTffvG~Vd 228 (369)
T KOG2738|consen 149 TDEIDRAVHNAIIERGAYPSPLNYYGFPKSVCTSVNEVICHGIPDSRPLEDGDIVNIDVTVYLNGYHGDLNETFFVGNVD 228 (369)
T ss_pred HHHHHHHHHHHHHhcCCcCCCcccCCCchhhhcchhheeecCCCCcCcCCCCCEEeEEEEEEeccccCccccceEeeccC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhhhcC
Q 026748 223 DEARNLVKGPCR 234 (234)
Q Consensus 223 ~e~~~l~e~~~E 234 (234)
++.++|+++++|
T Consensus 229 e~~k~LVkvT~E 240 (369)
T KOG2738|consen 229 EKAKKLVKVTRE 240 (369)
T ss_pred HHHHHHHHHHHH
Confidence 999999999875
|
|
| >PLN03158 methionine aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >COG0024 Map Methionine aminopeptidase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12897 methionine aminopeptidase; Reviewed | Back alignment and domain information |
|---|
| >PRK12318 methionine aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >PRK07281 methionine aminopeptidase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00500 met_pdase_I methionine aminopeptidase, type I | Back alignment and domain information |
|---|
| >PRK12896 methionine aminopeptidase; Reviewed | Back alignment and domain information |
|---|
| >PRK05716 methionine aminopeptidase; Validated | Back alignment and domain information |
|---|
| >COG0006 PepP Xaa-Pro aminopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10879 proline aminopeptidase P II; Provisional | Back alignment and domain information |
|---|
| >PRK09795 aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02993 ectoine_eutD ectoine utilization protein EutD | Back alignment and domain information |
|---|
| >PRK15173 peptidase; Provisional | Back alignment and domain information |
|---|
| >cd01090 Creatinase Creatine amidinohydrolase | Back alignment and domain information |
|---|
| >PRK14575 putative peptidase; Provisional | Back alignment and domain information |
|---|
| >cd01086 MetAP1 Methionine Aminopeptidase 1 | Back alignment and domain information |
|---|
| >cd01087 Prolidase Prolidase | Back alignment and domain information |
|---|
| >PRK14576 putative endopeptidase; Provisional | Back alignment and domain information |
|---|
| >PRK13607 proline dipeptidase; Provisional | Back alignment and domain information |
|---|
| >cd01092 APP-like Similar to Prolidase and Aminopeptidase P | Back alignment and domain information |
|---|
| >TIGR00495 crvDNA_42K 42K curved DNA binding protein | Back alignment and domain information |
|---|
| >cd01085 APP X-Prolyl Aminopeptidase 2 | Back alignment and domain information |
|---|
| >PF00557 Peptidase_M24: Metallopeptidase family M24 This Prosite entry corresponds to sub-family M24B This Prosite entry corresponds to sub-families M24A and M24C; InterPro: IPR000994 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd01089 PA2G4-like Related to aminopepdidase M, this family contains proliferation-associated protein 2G4 | Back alignment and domain information |
|---|
| >PTZ00053 methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >cd01066 APP_MetAP A family including aminopeptidase P, aminopeptidase M, and prolidase | Back alignment and domain information |
|---|
| >TIGR00501 met_pdase_II methionine aminopeptidase, type II | Back alignment and domain information |
|---|
| >PRK08671 methionine aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >cd01088 MetAP2 Methionine Aminopeptidase 2 | Back alignment and domain information |
|---|
| >KOG2414 consensus Putative Xaa-Pro aminopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2737 consensus Putative metallopeptidase [General function prediction only] | Back alignment and domain information |
|---|
| >cd01091 CDC68-like Related to aminopeptidase P and aminopeptidase M, a member of this domain family is present in cell division control protein 68, a transcription factor | Back alignment and domain information |
|---|
| >KOG2776 consensus Metallopeptidase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2413 consensus Xaa-Pro aminopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1189 consensus Global transcriptional regulator, cell division control protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2775 consensus Metallopeptidase [General function prediction only] | Back alignment and domain information |
|---|
| >COG5406 Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >cd01066 APP_MetAP A family including aminopeptidase P, aminopeptidase M, and prolidase | Back alignment and domain information |
|---|
| >cd01092 APP-like Similar to Prolidase and Aminopeptidase P | Back alignment and domain information |
|---|
| >PRK05716 methionine aminopeptidase; Validated | Back alignment and domain information |
|---|
| >cd01086 MetAP1 Methionine Aminopeptidase 1 | Back alignment and domain information |
|---|
| >PRK15173 peptidase; Provisional | Back alignment and domain information |
|---|
| >TIGR00500 met_pdase_I methionine aminopeptidase, type I | Back alignment and domain information |
|---|
| >PRK14575 putative peptidase; Provisional | Back alignment and domain information |
|---|
| >cd01090 Creatinase Creatine amidinohydrolase | Back alignment and domain information |
|---|
| >PRK09795 aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >PRK08671 methionine aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >PRK14576 putative endopeptidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02993 ectoine_eutD ectoine utilization protein EutD | Back alignment and domain information |
|---|
| >cd01088 MetAP2 Methionine Aminopeptidase 2 | Back alignment and domain information |
|---|
| >PRK12897 methionine aminopeptidase; Reviewed | Back alignment and domain information |
|---|
| >PRK12318 methionine aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >PF00557 Peptidase_M24: Metallopeptidase family M24 This Prosite entry corresponds to sub-family M24B This Prosite entry corresponds to sub-families M24A and M24C; InterPro: IPR000994 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd01091 CDC68-like Related to aminopeptidase P and aminopeptidase M, a member of this domain family is present in cell division control protein 68, a transcription factor | Back alignment and domain information |
|---|
| >PRK12896 methionine aminopeptidase; Reviewed | Back alignment and domain information |
|---|
| >cd01087 Prolidase Prolidase | Back alignment and domain information |
|---|
| >PRK07281 methionine aminopeptidase; Reviewed | Back alignment and domain information |
|---|
| >cd01089 PA2G4-like Related to aminopepdidase M, this family contains proliferation-associated protein 2G4 | Back alignment and domain information |
|---|
| >TIGR00501 met_pdase_II methionine aminopeptidase, type II | Back alignment and domain information |
|---|
| >PLN03158 methionine aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >COG0006 PepP Xaa-Pro aminopeptidase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00495 crvDNA_42K 42K curved DNA binding protein | Back alignment and domain information |
|---|
| >PTZ00053 methionine aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >COG0024 Map Methionine aminopeptidase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10879 proline aminopeptidase P II; Provisional | Back alignment and domain information |
|---|
| >cd01085 APP X-Prolyl Aminopeptidase 2 | Back alignment and domain information |
|---|
| >PRK13607 proline dipeptidase; Provisional | Back alignment and domain information |
|---|
| >KOG2738 consensus Putative methionine aminopeptidase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1189 consensus Global transcriptional regulator, cell division control protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 234 | ||||
| 3iu7_A | 288 | M. Tuberculosis Methionine Aminopeptidase With Mn I | 9e-47 | ||
| 1y1n_A | 291 | Identification Of Sh3 Motif In M. Tuberculosis Meth | 1e-46 | ||
| 3pka_A | 285 | M. Tuberculosis Metap With Bengamide Analog Y02, In | 1e-46 | ||
| 3ror_A | 291 | Crystal Structure Of C105s Mutant Of Mycobacterium | 9e-46 | ||
| 2b3h_A | 329 | Crystal Structure Of Human Methionine Aminopeptidas | 5e-42 | ||
| 4fli_A | 326 | Human Metap1 With Bengamide Analog Y16, In Mn Form | 1e-41 | ||
| 2g6p_A | 304 | Crystal Structure Of Truncated (Delta 1-89) Human M | 2e-41 | ||
| 4fuk_A | 337 | Aminopeptidase From Trypanosoma Brucei Length = 337 | 5e-40 | ||
| 3s6b_A | 368 | Crystal Structure Of Methionine Aminopeptidase 1b F | 3e-37 | ||
| 3mx6_A | 262 | Crystal Structure Of Methionine Aminopeptidase From | 2e-30 | ||
| 3mr1_A | 252 | Crystal Structure Of Methionine Aminopeptidase From | 3e-30 | ||
| 3mat_A | 265 | E.coli Methionine Aminopeptidase Transition-state I | 4e-27 | ||
| 4a6v_A | 265 | X-Ray Structures Of Oxazole Hydroxamate Ecmetap-Mn | 4e-27 | ||
| 2mat_A | 264 | E.Coli Methionine Aminopeptidase At 1.9 Angstrom Re | 4e-27 | ||
| 4mat_A | 278 | E.Coli Methionine Aminopeptidase His79ala Mutant Le | 4e-27 | ||
| 1xnz_A | 264 | Crystal Structure Of Mn(Ii) Form Of E. Coli. Methio | 4e-27 | ||
| 2gg0_A | 263 | Novel Bacterial Methionine Aminopeptidase Inhibitor | 4e-27 | ||
| 2gtx_A | 261 | Structural Basis Of Catalysis By Mononuclear Methio | 4e-27 | ||
| 2gu4_A | 263 | E. Coli Methionine Aminopeptidase In Complex With N | 4e-27 | ||
| 2p98_A | 262 | E. Coli Methionine Aminopeptidase Monometalated Wit | 4e-27 | ||
| 1c27_A | 263 | E. Coli Methionine Aminopeptidase:norleucine Phosph | 4e-27 | ||
| 2p99_A | 261 | E. Coli Methionine Aminopeptidase Monometalated Wit | 5e-27 | ||
| 3tav_A | 286 | Crystal Structure Of A Methionine Aminopeptidase Fr | 1e-19 | ||
| 1qxw_A | 252 | Crystal Structure Of Staphyloccocus Aureus In Compl | 2e-19 | ||
| 3tb5_A | 264 | Crystal Structure Of The Enterococcus Faecalis Meth | 2e-16 | ||
| 1o0x_A | 262 | Crystal Structure Of Methionine Aminopeptidase (Tm1 | 2e-14 | ||
| 2dfi_A | 301 | Crystal Structure Of Pf-Map(1-292)-C Length = 301 | 9e-11 | ||
| 1xgs_A | 295 | Methionine Aminopeptidase From Hyperthermophile Pyr | 1e-10 | ||
| 3q6d_A | 356 | Xaa-Pro Dipeptidase From Bacillus Anthracis. Length | 3e-06 | ||
| 1wl9_A | 440 | Structure Of Aminopeptidase P From E. Coli Length = | 3e-05 | ||
| 2v3z_A | 440 | Glu383ala Escherichia Coli Aminopeptidase P In Comp | 3e-05 | ||
| 2bwv_A | 440 | His361ala Escherichia Coli Aminopeptidase P Length | 3e-05 | ||
| 1m35_A | 440 | Aminopeptidase P From Escherichia Coli Length = 440 | 6e-05 | ||
| 2bwy_A | 440 | Glu383ala Escherichia Coli Aminopeptidase P Length | 7e-05 | ||
| 1jaw_A | 440 | Aminopeptidase P From E. Coli Low Ph Form Length = | 7e-05 | ||
| 2bww_A | 440 | His350ala Escherichia Coli Aminopeptidase P Length | 7e-05 | ||
| 2bws_A | 440 | His243ala Escherichia Coli Aminopeptidase P Length | 4e-04 | ||
| 2v6c_A | 353 | Crystal Structure Of Erbb3 Binding Protein 1 (Ebp1) | 4e-04 | ||
| 2bwt_A | 440 | Asp260ala Escherichia Coli Aminopeptidase P Length | 5e-04 | ||
| 2bwu_A | 440 | Asp271ala Escherichia Coli Aminopeptidase P Length | 5e-04 | ||
| 2bwx_A | 441 | His354ala Escherichia Coli Aminopeptidase P Length | 7e-04 |
| >pdb|3IU7|A Chain A, M. Tuberculosis Methionine Aminopeptidase With Mn Inhibitor A02 Length = 288 | Back alignment and structure |
|
| >pdb|1Y1N|A Chain A, Identification Of Sh3 Motif In M. Tuberculosis Methionine Aminopeptidase Suggests A Mode Of Interaction With The Ribosome Length = 291 | Back alignment and structure |
| >pdb|3PKA|A Chain A, M. Tuberculosis Metap With Bengamide Analog Y02, In Mn Form Length = 285 | Back alignment and structure |
| >pdb|3ROR|A Chain A, Crystal Structure Of C105s Mutant Of Mycobacterium Tuberculosis Methionine Aminopeptidase Length = 291 | Back alignment and structure |
| >pdb|2B3H|A Chain A, Crystal Structure Of Human Methionine Aminopeptidase Type I With A Third Cobalt In The Active Site Length = 329 | Back alignment and structure |
| >pdb|4FLI|A Chain A, Human Metap1 With Bengamide Analog Y16, In Mn Form Length = 326 | Back alignment and structure |
| >pdb|2G6P|A Chain A, Crystal Structure Of Truncated (Delta 1-89) Human Methionine Aminopeptidase Type 1 In Complex With Pyridyl Pyrimidine Derivative Length = 304 | Back alignment and structure |
| >pdb|4FUK|A Chain A, Aminopeptidase From Trypanosoma Brucei Length = 337 | Back alignment and structure |
| >pdb|3S6B|A Chain A, Crystal Structure Of Methionine Aminopeptidase 1b From Plasmodium Falciparum, Pf10_0150 Length = 368 | Back alignment and structure |
| >pdb|3MX6|A Chain A, Crystal Structure Of Methionine Aminopeptidase From Ricketts Prowazekii Bound To Methionine Length = 262 | Back alignment and structure |
| >pdb|3MR1|A Chain A, Crystal Structure Of Methionine Aminopeptidase From Ricketts Prowazekii Length = 252 | Back alignment and structure |
| >pdb|3MAT|A Chain A, E.coli Methionine Aminopeptidase Transition-state Inhibitor Complex Length = 265 | Back alignment and structure |
| >pdb|4A6V|A Chain A, X-Ray Structures Of Oxazole Hydroxamate Ecmetap-Mn Complexes Length = 265 | Back alignment and structure |
| >pdb|2MAT|A Chain A, E.Coli Methionine Aminopeptidase At 1.9 Angstrom Resolution Length = 264 | Back alignment and structure |
| >pdb|4MAT|A Chain A, E.Coli Methionine Aminopeptidase His79ala Mutant Length = 278 | Back alignment and structure |
| >pdb|1XNZ|A Chain A, Crystal Structure Of Mn(Ii) Form Of E. Coli. Methionine Aminopeptidase In Complex With 5-(2-Chlorophenyl)furan-2- Carboxylic Acid Length = 264 | Back alignment and structure |
| >pdb|2GG0|A Chain A, Novel Bacterial Methionine Aminopeptidase Inhibitors Length = 263 | Back alignment and structure |
| >pdb|2GTX|A Chain A, Structural Basis Of Catalysis By Mononuclear Methionine Aminopeptidase Length = 261 | Back alignment and structure |
| >pdb|2GU4|A Chain A, E. Coli Methionine Aminopeptidase In Complex With Nlep, 1: 0.5, Di-Metalated Length = 263 | Back alignment and structure |
| >pdb|2P98|A Chain A, E. Coli Methionine Aminopeptidase Monometalated With Inhibitor Ye7 Length = 262 | Back alignment and structure |
| >pdb|1C27|A Chain A, E. Coli Methionine Aminopeptidase:norleucine Phosphonate Complex Length = 263 | Back alignment and structure |
| >pdb|2P99|A Chain A, E. Coli Methionine Aminopeptidase Monometalated With Inhibitor Ye6 Length = 261 | Back alignment and structure |
| >pdb|3TAV|A Chain A, Crystal Structure Of A Methionine Aminopeptidase From Mycobacterium Abscessus Length = 286 | Back alignment and structure |
| >pdb|1QXW|A Chain A, Crystal Structure Of Staphyloccocus Aureus In Complex With An Aminoketone Inhibitor 54135. Length = 252 | Back alignment and structure |
| >pdb|3TB5|A Chain A, Crystal Structure Of The Enterococcus Faecalis Methionine Aminopeptidase Apo Form Length = 264 | Back alignment and structure |
| >pdb|1O0X|A Chain A, Crystal Structure Of Methionine Aminopeptidase (Tm1478) From Thermotoga Maritima At 1.90 A Resolution Length = 262 | Back alignment and structure |
| >pdb|2DFI|A Chain A, Crystal Structure Of Pf-Map(1-292)-C Length = 301 | Back alignment and structure |
| >pdb|1XGS|A Chain A, Methionine Aminopeptidase From Hyperthermophile Pyrococcus Furiosus Length = 295 | Back alignment and structure |
| >pdb|3Q6D|A Chain A, Xaa-Pro Dipeptidase From Bacillus Anthracis. Length = 356 | Back alignment and structure |
| >pdb|1WL9|A Chain A, Structure Of Aminopeptidase P From E. Coli Length = 440 | Back alignment and structure |
| >pdb|2V3Z|A Chain A, Glu383ala Escherichia Coli Aminopeptidase P In Complex With Substrate Length = 440 | Back alignment and structure |
| >pdb|2BWV|A Chain A, His361ala Escherichia Coli Aminopeptidase P Length = 440 | Back alignment and structure |
| >pdb|1M35|A Chain A, Aminopeptidase P From Escherichia Coli Length = 440 | Back alignment and structure |
| >pdb|2BWY|A Chain A, Glu383ala Escherichia Coli Aminopeptidase P Length = 440 | Back alignment and structure |
| >pdb|1JAW|A Chain A, Aminopeptidase P From E. Coli Low Ph Form Length = 440 | Back alignment and structure |
| >pdb|2BWW|A Chain A, His350ala Escherichia Coli Aminopeptidase P Length = 440 | Back alignment and structure |
| >pdb|2BWS|A Chain A, His243ala Escherichia Coli Aminopeptidase P Length = 440 | Back alignment and structure |
| >pdb|2V6C|A Chain A, Crystal Structure Of Erbb3 Binding Protein 1 (Ebp1) Length = 353 | Back alignment and structure |
| >pdb|2BWT|A Chain A, Asp260ala Escherichia Coli Aminopeptidase P Length = 440 | Back alignment and structure |
| >pdb|2BWU|A Chain A, Asp271ala Escherichia Coli Aminopeptidase P Length = 440 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 234 | |||
| 3pka_A | 285 | Methionine aminopeptidase; hydrolase-hydrolase inh | 1e-102 | |
| 3s6b_A | 368 | Methionine aminopeptidase; malaria, proteolysis, " | 2e-98 | |
| 2b3h_A | 329 | Methionine aminopeptidase 1; hydrolase, metallopro | 4e-96 | |
| 3mx6_A | 262 | Methionine aminopeptidase; seattle structural geno | 6e-76 | |
| 2gg2_A | 263 | Methionine aminopeptidase; PITA-bread fold, MAP in | 5e-69 | |
| 1qxy_A | 252 | Methionyl aminopeptidase; PITA bread fold, hydrola | 4e-68 | |
| 3tb5_A | 264 | Methionine aminopeptidase; hydrolase, metalloprote | 4e-64 | |
| 1o0x_A | 262 | Methionine aminopeptidase; TM1478, structural geno | 9e-62 | |
| 3tav_A | 286 | Methionine aminopeptidase; ssgcid, seattle structu | 2e-59 | |
| 1xgs_A | 295 | Methionine aminopeptidase; hyperthermophIle; 1.75A | 8e-38 | |
| 2q8k_A | 401 | Proliferation-associated protein 2G4; EBP1, PA2G4, | 3e-37 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 3e-32 | |
| 2nw5_A | 360 | Methionine aminopeptidase 2; metap2, structural ge | 1e-30 | |
| 1wy2_A | 351 | XAA-Pro dipeptidase; structural genomics, prolidas | 2e-17 | |
| 2zsg_A | 359 | Aminopeptidase P, putative; hydrolase; 1.65A {Ther | 5e-17 | |
| 3q6d_A | 356 | Proline dipeptidase; structural genomics, csgid, c | 5e-17 | |
| 1wn1_A | 356 | Dipeptidase; prolidase, cobalt(II), structural gen | 6e-17 | |
| 1chm_A | 401 | Creatine amidinohydrolase; creatinase; 1.90A {Pseu | 4e-16 | |
| 4ege_A | 378 | Dipeptidase PEPE; structural genomics, seattle str | 4e-16 | |
| 1kp0_A | 402 | Creatine amidinohydrolase; alpha betal, 3-layer(AB | 9e-16 | |
| 4b28_A | 470 | Metallopeptidase, family M24, putative; lyase, ime | 1e-09 | |
| 3cb6_A | 444 | FACT complex subunit SPT16; peptidase homology dom | 3e-09 | |
| 3biq_A | 467 | FACT complex subunit SPT16; PITA-bread, aminopepti | 8e-08 | |
| 3ig4_A | 427 | XAA-Pro aminopeptidase; csgid, hydrolase, struct g | 3e-05 | |
| 2v3z_A | 440 | XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proli | 8e-05 | |
| 3l24_A | 517 | XAA-Pro dipeptidase; PITA-bread, detoxification, h | 3e-04 |
| >3pka_A Methionine aminopeptidase; hydrolase-hydrolase inhibitor complex; HET: Y02; 1.25A {Mycobacterium tuberculosis} PDB: 3pkb_A* 3pkc_A* 3pkd_A* 3pke_A* 3iu7_A* 3iu8_A* 3iu9_A* 1y1n_A 1yj3_A Length = 285 | Back alignment and structure |
|---|
Score = 297 bits (763), Expect = e-102
Identities = 92/159 (57%), Positives = 108/159 (67%), Gaps = 1/159 (0%)
Query: 72 RKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMRVSGRLAAQVLE 131
R L PG +SP RPVP+ I RP YV S P V + IE MRV+GR+AA L
Sbjct: 4 RTALSPGVLSPTRPVPNWIARPEYVGKPAAQ-EGSEPWVQTPEVIEKMRVAGRIAAGALA 62
Query: 132 YAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRAL 191
AG V PG+TTDE+D+ H+ ++DNGAYPS LGY GFPKS CTS+NE ICHGIPDS +
Sbjct: 63 EAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPDSTVI 122
Query: 192 EDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVK 230
DGD +NIDVT Y+ G HGDT+ATF GDV DE R LV
Sbjct: 123 TDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVD 161
|
| >3s6b_A Methionine aminopeptidase; malaria, proteolysis, "PITA bread" fold, structur genomics, structural genomics consortium, SGC, hydrolase; 1.95A {Plasmodium falciparum} Length = 368 | Back alignment and structure |
|---|
| >2b3h_A Methionine aminopeptidase 1; hydrolase, metalloprotease, pitab; HET: GOL; 1.10A {Homo sapiens} PDB: 2b3k_A 2b3l_A 2gz5_A* 2nq6_A* 2nq7_A* 2g6p_A* Length = 329 | Back alignment and structure |
|---|
| >3mx6_A Methionine aminopeptidase; seattle structural genomics center for infectious disease, S aminopeptidase, protease, epidermic typhus; 1.70A {Rickettsia prowazekii} PDB: 3mr1_A Length = 262 | Back alignment and structure |
|---|
| >2gg2_A Methionine aminopeptidase; PITA-bread fold, MAP inhibitor, antibacterial, hydrolase; HET: U12; 1.00A {Escherichia coli K12} SCOP: d.127.1.1 PDB: 2gg0_A* 2gg3_A* 2gg5_A* 2gg7_A* 2gg8_A* 2gg9_A* 2ggb_A* 2ggc_A 2q93_A* 2q95_A* 2q96_A* 1xnz_A* 1mat_A* 2bb7_A* 2evc_A* 2evm_A* 2evo_A* 3mat_A* 1yvm_A* 2mat_A ... Length = 263 | Back alignment and structure |
|---|
| >1qxy_A Methionyl aminopeptidase; PITA bread fold, hydrolase; HET: M2C; 1.04A {Staphylococcus aureus} SCOP: d.127.1.1 PDB: 1qxw_A* 1qxz_A* Length = 252 | Back alignment and structure |
|---|
| >3tb5_A Methionine aminopeptidase; hydrolase, metalloprotease, enter feacalis; HET: CIT; 2.30A {Enterococcus faecalis} Length = 264 | Back alignment and structure |
|---|
| >1o0x_A Methionine aminopeptidase; TM1478, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Thermotoga maritima} SCOP: d.127.1.1 Length = 262 | Back alignment and structure |
|---|
| >3tav_A Methionine aminopeptidase; ssgcid, seattle structural genomics center for infectious DI protease, hydrolase; 2.15A {Mycobacterium abscessus} Length = 286 | Back alignment and structure |
|---|
| >1xgs_A Methionine aminopeptidase; hyperthermophIle; 1.75A {Pyrococcus furiosus} SCOP: a.4.5.25 d.127.1.1 PDB: 1xgm_A 1xgn_A 1xgo_A 1wkm_A 2dfi_A Length = 295 | Back alignment and structure |
|---|
| >2q8k_A Proliferation-associated protein 2G4; EBP1, PA2G4, methionine aminopeptidase, PITA-bread, transcri; 1.60A {Homo sapiens} PDB: 2v6c_A Length = 401 | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 | Back alignment and structure |
|---|
| >1wy2_A XAA-Pro dipeptidase; structural genomics, prolidase, riken structural genomics/PR initiative, RSGI, hydrolase; 1.70A {Pyrococcus horikoshii} PDB: 1pv9_A Length = 351 | Back alignment and structure |
|---|
| >2zsg_A Aminopeptidase P, putative; hydrolase; 1.65A {Thermotoga maritima} Length = 359 | Back alignment and structure |
|---|
| >3q6d_A Proline dipeptidase; structural genomics, csgid, center for structural genomics O infectious diseases, aminopeptidase, viral protein; 1.97A {Bacillus anthracis} Length = 356 | Back alignment and structure |
|---|
| >1wn1_A Dipeptidase; prolidase, cobalt(II), structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; 2.25A {Pyrococcus horikoshii} PDB: 2how_A Length = 356 | Back alignment and structure |
|---|
| >1chm_A Creatine amidinohydrolase; creatinase; 1.90A {Pseudomonas putida} SCOP: c.55.2.1 d.127.1.1 Length = 401 | Back alignment and structure |
|---|
| >4ege_A Dipeptidase PEPE; structural genomics, seattle structural genomics center for infectious disease, ssgcid, hydrolase; 2.20A {Mycobacterium ulcerans} Length = 378 | Back alignment and structure |
|---|
| >1kp0_A Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sandwich; 2.70A {Actinobacillus} SCOP: c.55.2.1 d.127.1.1 Length = 402 | Back alignment and structure |
|---|
| >4b28_A Metallopeptidase, family M24, putative; lyase, imethylsulfonioproionate, acrylate, dimethylsulfide; 2.15A {Roseobacter denitrificans och 114} Length = 470 | Back alignment and structure |
|---|
| >3cb6_A FACT complex subunit SPT16; peptidase homology domain, histone binding module, histone H chaperone, PITA-bread fold; 1.84A {Schizosaccharomyces pombe} PDB: 3cb5_A Length = 444 | Back alignment and structure |
|---|
| >3biq_A FACT complex subunit SPT16; PITA-bread, aminopeptidase, chromatin, replication, AC chromosomal protein, DNA damage, DNA repair; 1.73A {Saccharomyces cerevisiae} PDB: 3bip_A 3bit_A* Length = 467 | Back alignment and structure |
|---|
| >3ig4_A XAA-Pro aminopeptidase; csgid, hydrolase, struct genomics, center for structural genomics of infectious DISE; HET: SO4; 2.89A {Bacillus anthracis} Length = 427 | Back alignment and structure |
|---|
| >2v3z_A XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- specific enzyme, aminopeptidas manganese enzyme, protease, manganese; HET: CSO; 1.56A {Escherichia coli} SCOP: c.55.2.1 d.127.1.1 PDB: 2bwy_A* 1wl9_A 1m35_A 1n51_A* 1w2m_A 1a16_A 1wbq_A 1wl6_A* 1w7v_A 1wlr_A* 2bh3_A* 2bha_A* 2bhb_A* 2bhc_A* 2bhd_A* 2bn7_A* 1jaw_A 2bwt_A* 2bwu_A* 2bww_A* ... Length = 440 | Back alignment and structure |
|---|
| >3l24_A XAA-Pro dipeptidase; PITA-bread, detoxification, hydrolase, manganese, metal-binding, metalloprotease, protease; 2.30A {Alteromonas SP} PDB: 3l7g_A* Length = 517 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 234 | |||
| 4fuk_A | 337 | Methionine aminopeptidase; structural genomics con | 100.0 | |
| 3s6b_A | 368 | Methionine aminopeptidase; malaria, proteolysis, " | 100.0 | |
| 2b3h_A | 329 | Methionine aminopeptidase 1; hydrolase, metallopro | 100.0 | |
| 3pka_A | 285 | Methionine aminopeptidase; hydrolase-hydrolase inh | 100.0 | |
| 3tb5_A | 264 | Methionine aminopeptidase; hydrolase, metalloprote | 100.0 | |
| 3mx6_A | 262 | Methionine aminopeptidase; seattle structural geno | 99.97 | |
| 1o0x_A | 262 | Methionine aminopeptidase; TM1478, structural geno | 99.97 | |
| 3tav_A | 286 | Methionine aminopeptidase; ssgcid, seattle structu | 99.97 | |
| 2gg2_A | 263 | Methionine aminopeptidase; PITA-bread fold, MAP in | 99.97 | |
| 1qxy_A | 252 | Methionyl aminopeptidase; PITA bread fold, hydrola | 99.97 | |
| 3q6d_A | 356 | Proline dipeptidase; structural genomics, csgid, c | 99.96 | |
| 2zsg_A | 359 | Aminopeptidase P, putative; hydrolase; 1.65A {Ther | 99.96 | |
| 1wy2_A | 351 | XAA-Pro dipeptidase; structural genomics, prolidas | 99.96 | |
| 3fm3_A | 358 | Methionine aminopeptidase 2; metap2, structural ge | 99.95 | |
| 1wn1_A | 356 | Dipeptidase; prolidase, cobalt(II), structural gen | 99.95 | |
| 3ig4_A | 427 | XAA-Pro aminopeptidase; csgid, hydrolase, struct g | 99.95 | |
| 2q8k_A | 401 | Proliferation-associated protein 2G4; EBP1, PA2G4, | 99.95 | |
| 2v3z_A | 440 | XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proli | 99.95 | |
| 4fkc_A | 377 | XAA-Pro aminopeptidase; PITA-bread structure, prol | 99.95 | |
| 4ege_A | 378 | Dipeptidase PEPE; structural genomics, seattle str | 99.95 | |
| 1kp0_A | 402 | Creatine amidinohydrolase; alpha betal, 3-layer(AB | 99.94 | |
| 2iw2_A | 494 | XAA-Pro dipeptidase; metallocarboxypeptidase, dise | 99.93 | |
| 3rva_A | 451 | Organophosphorus acid anhydrolase; PITA-bread fold | 99.93 | |
| 1chm_A | 401 | Creatine amidinohydrolase; creatinase; 1.90A {Pseu | 99.93 | |
| 3biq_A | 467 | FACT complex subunit SPT16; PITA-bread, aminopepti | 99.92 | |
| 4b28_A | 470 | Metallopeptidase, family M24, putative; lyase, ime | 99.92 | |
| 3l24_A | 517 | XAA-Pro dipeptidase; PITA-bread, detoxification, h | 99.92 | |
| 3cb6_A | 444 | FACT complex subunit SPT16; peptidase homology dom | 99.91 | |
| 1xgs_A | 295 | Methionine aminopeptidase; hyperthermophIle; 1.75A | 99.91 | |
| 2nw5_A | 360 | Methionine aminopeptidase 2; metap2, structural ge | 99.91 | |
| 3ctz_A | 623 | XAA-Pro aminopeptidase 1; PITA-bread fold, alterna | 99.89 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 99.88 | |
| 4b6a_t | 614 | Probable metalloprotease ARX1; large ribosomal sub | 99.57 | |
| 3q6d_A | 356 | Proline dipeptidase; structural genomics, csgid, c | 97.52 | |
| 4ege_A | 378 | Dipeptidase PEPE; structural genomics, seattle str | 97.42 | |
| 2zsg_A | 359 | Aminopeptidase P, putative; hydrolase; 1.65A {Ther | 97.37 | |
| 1wy2_A | 351 | XAA-Pro dipeptidase; structural genomics, prolidas | 97.37 | |
| 1wn1_A | 356 | Dipeptidase; prolidase, cobalt(II), structural gen | 97.33 | |
| 1o0x_A | 262 | Methionine aminopeptidase; TM1478, structural geno | 97.17 | |
| 2gg2_A | 263 | Methionine aminopeptidase; PITA-bread fold, MAP in | 97.15 | |
| 3mx6_A | 262 | Methionine aminopeptidase; seattle structural geno | 97.1 | |
| 1qxy_A | 252 | Methionyl aminopeptidase; PITA bread fold, hydrola | 97.08 | |
| 4fkc_A | 377 | XAA-Pro aminopeptidase; PITA-bread structure, prol | 97.05 | |
| 3pka_A | 285 | Methionine aminopeptidase; hydrolase-hydrolase inh | 97.03 | |
| 3cb6_A | 444 | FACT complex subunit SPT16; peptidase homology dom | 96.99 | |
| 1kp0_A | 402 | Creatine amidinohydrolase; alpha betal, 3-layer(AB | 96.93 | |
| 3tb5_A | 264 | Methionine aminopeptidase; hydrolase, metalloprote | 96.89 | |
| 3biq_A | 467 | FACT complex subunit SPT16; PITA-bread, aminopepti | 96.88 | |
| 3tav_A | 286 | Methionine aminopeptidase; ssgcid, seattle structu | 96.75 | |
| 3ig4_A | 427 | XAA-Pro aminopeptidase; csgid, hydrolase, struct g | 96.68 | |
| 1chm_A | 401 | Creatine amidinohydrolase; creatinase; 1.90A {Pseu | 96.63 | |
| 1xgs_A | 295 | Methionine aminopeptidase; hyperthermophIle; 1.75A | 96.59 | |
| 2v3z_A | 440 | XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proli | 96.55 | |
| 3s6b_A | 368 | Methionine aminopeptidase; malaria, proteolysis, " | 96.5 | |
| 2b3h_A | 329 | Methionine aminopeptidase 1; hydrolase, metallopro | 96.48 | |
| 2q8k_A | 401 | Proliferation-associated protein 2G4; EBP1, PA2G4, | 95.89 | |
| 3rva_A | 451 | Organophosphorus acid anhydrolase; PITA-bread fold | 95.8 | |
| 2nw5_A | 360 | Methionine aminopeptidase 2; metap2, structural ge | 95.78 | |
| 3ctz_A | 623 | XAA-Pro aminopeptidase 1; PITA-bread fold, alterna | 95.57 | |
| 3l24_A | 517 | XAA-Pro dipeptidase; PITA-bread, detoxification, h | 95.46 | |
| 4fuk_A | 337 | Methionine aminopeptidase; structural genomics con | 95.36 | |
| 4b28_A | 470 | Metallopeptidase, family M24, putative; lyase, ime | 95.2 | |
| 1b6a_A | 478 | Methionine aminopeptidase; angiogenesis inhibitor; | 95.14 | |
| 2iw2_A | 494 | XAA-Pro dipeptidase; metallocarboxypeptidase, dise | 94.77 | |
| 3fm3_A | 358 | Methionine aminopeptidase 2; metap2, structural ge | 86.53 |
| >4fuk_A Methionine aminopeptidase; structural genomics consortium, SGC, hydrolase; 1.75A {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.2e-42 Score=315.03 Aligned_cols=167 Identities=47% Similarity=0.818 Sum_probs=154.8
Q ss_pred CCCCccCCCcccCCCCCCCCCCCCCCCCccCCCCC----------------CCCCCCccCCHHHHHHHHHHHHHHHHHHH
Q 026748 68 PNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPI----------------GIVSGPEVHDEKGIECMRVSGRLAAQVLE 131 (234)
Q Consensus 68 ~~~~~~~l~~g~~s~~~~vp~~i~~p~y~~~~~~~----------------~~~~~R~VKs~eEIe~mR~Aa~ia~~al~ 131 (234)
+|+|+|+||||++||++.||+||++|+|+...... .....|.|||++||+.||+||+|++++++
T Consensus 5 ~~~~~g~~~p~~~sp~~~vP~~i~~p~y~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~VKs~~EI~~mR~A~~i~~~a~~ 84 (337)
T 4fuk_A 5 TFDFTGPLRPGKITPRRAVPSHILRPDYADRAGGVSASEEKDRGSKVKVYNIQFLHDDSKKTAEIQRIKTVCQLSREVLD 84 (337)
T ss_dssp CCCCCSSCCCCCCCCCCCCCTTSCCCTTSSSTTCCCHHHHHHTTCCCCCCCCTTTTCTTC--CHHHHHHHHHHHHHHHHH
T ss_pred CcceecccccccCCCCCCCCCCCCCCCcccCCCCCCccccccccCccccccchhhcccCCCHHHHHHHHHHHHHHHHHHH
Confidence 58999999999999999999999999999653211 12346899999999999999999999999
Q ss_pred HHhhhcCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCeeeecCCCceeccCCCCCCCCCCCEEEEEEeeEECCEEec
Q 026748 132 YAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGD 211 (234)
Q Consensus 132 ~~~~~ikpGvTe~EI~~~v~~~l~~~Ga~ps~l~y~gFp~~v~sg~N~~~~Hg~P~~r~L~~GDiV~iDvg~~~~GY~~D 211 (234)
.+.+.++||+||.||++.+++++.++|+++++.+|.+||+++|+|.|+++||++|++++|++||+|++|+|+.|+||++|
T Consensus 85 ~~~~~ikpG~te~el~~~~~~~~~~~g~~~~~~~~~~fp~iv~~g~n~~~~H~~~~~~~l~~GD~v~iD~g~~~~GY~sD 164 (337)
T 4fuk_A 85 IATAAAKPGITTDELDRIVHEATVERNMYPSPLNYYGFPKSVCTSVNEVICHGIPDSRELEEGDILNIDVSSYLNGFHGD 164 (337)
T ss_dssp HHHHHCCTTCBHHHHHHHHHHHHHHTTCEETTTTGGGCCSSSEEEETTEEECCCCCSCBCCTTCEEEEEEEEEETTEEEE
T ss_pred HHHHHccCCCCHHHHHHHHHHHHHHcCCCccCCCCCCcCceeeccccccccCCCCCCccccCCCEEEEecceeECCEEEe
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eeeEEEcCCCCHHHHHHHhhhcC
Q 026748 212 TSATFFCGDVDDEARNLVKGPCR 234 (234)
Q Consensus 212 ~sRTf~VG~~s~e~~~l~e~~~E 234 (234)
++|||++|+++++++++|++++|
T Consensus 165 ~tRT~~vG~~~~~~~~l~~~v~e 187 (337)
T 4fuk_A 165 LNETVFIGRPDDDSVRLVHAAYE 187 (337)
T ss_dssp EEEEEESSSCCHHHHHHHHHHHH
T ss_pred eeeeEEeCCccHHHHHHHHHHHH
Confidence 99999999999999999998864
|
| >3s6b_A Methionine aminopeptidase; malaria, proteolysis, "PITA bread" fold, structur genomics, structural genomics consortium, SGC, hydrolase; 1.95A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2b3h_A Methionine aminopeptidase 1; hydrolase, metalloprotease, pitab; HET: GOL; 1.10A {Homo sapiens} PDB: 2b3k_A 2b3l_A 2gz5_A* 2nq6_A* 2nq7_A* 2g6p_A* | Back alignment and structure |
|---|
| >3pka_A Methionine aminopeptidase; hydrolase-hydrolase inhibitor complex; HET: Y02; 1.25A {Mycobacterium tuberculosis} PDB: 3pkb_A* 3pkc_A* 3pkd_A* 3pke_A* 3iu7_A* 3iu8_A* 3iu9_A* 1y1n_A 1yj3_A 3ror_A | Back alignment and structure |
|---|
| >3tb5_A Methionine aminopeptidase; hydrolase, metalloprotease, enter feacalis; HET: CIT; 2.30A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3mx6_A Methionine aminopeptidase; seattle structural genomics center for infectious disease, S aminopeptidase, protease, epidermic typhus; 1.70A {Rickettsia prowazekii} PDB: 3mr1_A | Back alignment and structure |
|---|
| >1o0x_A Methionine aminopeptidase; TM1478, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Thermotoga maritima} SCOP: d.127.1.1 | Back alignment and structure |
|---|
| >3tav_A Methionine aminopeptidase; ssgcid, seattle structural genomics center for infectious DI protease, hydrolase; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2gg2_A Methionine aminopeptidase; PITA-bread fold, MAP inhibitor, antibacterial, hydrolase; HET: U12; 1.00A {Escherichia coli K12} SCOP: d.127.1.1 PDB: 2gg0_A* 2gg3_A* 2gg5_A* 2gg7_A* 2gg8_A* 2gg9_A* 2ggb_A* 2ggc_A 2q93_A* 2q95_A* 2q96_A* 1xnz_A* 1mat_A* 2bb7_A* 2evc_A* 2evm_A* 2evo_A* 3mat_A* 1yvm_A* 2mat_A ... | Back alignment and structure |
|---|
| >1qxy_A Methionyl aminopeptidase; PITA bread fold, hydrolase; HET: M2C; 1.04A {Staphylococcus aureus} SCOP: d.127.1.1 PDB: 1qxw_A* 1qxz_A* | Back alignment and structure |
|---|
| >3q6d_A Proline dipeptidase; structural genomics, csgid, center for structural genomics O infectious diseases, aminopeptidase, viral protein; 1.97A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2zsg_A Aminopeptidase P, putative; hydrolase; 1.65A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1wy2_A XAA-Pro dipeptidase; structural genomics, prolidase, riken structural genomics/PR initiative, RSGI, hydrolase; 1.70A {Pyrococcus horikoshii} PDB: 1pv9_A | Back alignment and structure |
|---|
| >3fm3_A Methionine aminopeptidase 2; metap2, structural genomics, PSI-2, protein structure initiative; 2.18A {Encephalitozoon cuniculi} PDB: 3fmq_A* 3fmr_A* | Back alignment and structure |
|---|
| >1wn1_A Dipeptidase; prolidase, cobalt(II), structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; 2.25A {Pyrococcus horikoshii} PDB: 2how_A | Back alignment and structure |
|---|
| >3ig4_A XAA-Pro aminopeptidase; csgid, hydrolase, struct genomics, center for structural genomics of infectious DISE; HET: SO4; 2.89A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2q8k_A Proliferation-associated protein 2G4; EBP1, PA2G4, methionine aminopeptidase, PITA-bread, transcri; 1.60A {Homo sapiens} PDB: 2v6c_A | Back alignment and structure |
|---|
| >2v3z_A XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- specific enzyme, aminopeptidas manganese enzyme, protease, manganese; HET: CSO; 1.56A {Escherichia coli} SCOP: c.55.2.1 d.127.1.1 PDB: 2bwy_A* 1wl9_A 1m35_A 1n51_A* 1w2m_A 1a16_A 1wbq_A 1wl6_A* 1w7v_A 1wlr_A* 2bh3_A* 2bha_A* 2bhb_A* 2bhc_A* 2bhd_A* 2bn7_A* 1jaw_A 2bwt_A* 2bwu_A* 2bww_A* ... | Back alignment and structure |
|---|
| >4fkc_A XAA-Pro aminopeptidase; PITA-bread structure, prolidase, hydrolase; 2.60A {Thermococcus sibiricus} | Back alignment and structure |
|---|
| >4ege_A Dipeptidase PEPE; structural genomics, seattle structural genomics center for infectious disease, ssgcid, hydrolase; 2.20A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >1kp0_A Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sandwich; 2.70A {Actinobacillus} SCOP: c.55.2.1 d.127.1.1 | Back alignment and structure |
|---|
| >2iw2_A XAA-Pro dipeptidase; metallocarboxypeptidase, disease mutation, XAA-Pro dipeptida dipeptidase, peptidase D, collagen degradation; 1.82A {Homo sapiens} PDB: 2okn_A | Back alignment and structure |
|---|
| >3rva_A Organophosphorus acid anhydrolase; PITA-bread fold, binuclea center, BI-functional, prolidase, nerve agents, XAA-Pro DIP hydrolase; 1.80A {Alteromonas macleodii} | Back alignment and structure |
|---|
| >1chm_A Creatine amidinohydrolase; creatinase; 1.90A {Pseudomonas putida} SCOP: c.55.2.1 d.127.1.1 | Back alignment and structure |
|---|
| >3biq_A FACT complex subunit SPT16; PITA-bread, aminopeptidase, chromatin, replication, AC chromosomal protein, DNA damage, DNA repair; 1.73A {Saccharomyces cerevisiae} PDB: 3bip_A 3bit_A* | Back alignment and structure |
|---|
| >4b28_A Metallopeptidase, family M24, putative; lyase, imethylsulfonioproionate, acrylate, dimethylsulfide; 2.15A {Roseobacter denitrificans och 114} | Back alignment and structure |
|---|
| >3l24_A XAA-Pro dipeptidase; PITA-bread, detoxification, hydrolase, manganese, metal-binding, metalloprotease, protease; 2.30A {Alteromonas SP} PDB: 3l7g_A* | Back alignment and structure |
|---|
| >3cb6_A FACT complex subunit SPT16; peptidase homology domain, histone binding module, histone H chaperone, PITA-bread fold; 1.84A {Schizosaccharomyces pombe} PDB: 3cb5_A | Back alignment and structure |
|---|
| >1xgs_A Methionine aminopeptidase; hyperthermophIle; 1.75A {Pyrococcus furiosus} SCOP: a.4.5.25 d.127.1.1 PDB: 1xgm_A 1xgn_A 1xgo_A 1wkm_A 2dfi_A | Back alignment and structure |
|---|
| >3ctz_A XAA-Pro aminopeptidase 1; PITA-bread fold, alternative splicing, cytoplasm, hydrolase, manganese, metal-binding, metalloprotease, protease; HET: P6G; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* | Back alignment and structure |
|---|
| >4b6a_t Probable metalloprotease ARX1; large ribosomal subunit, ribosome biogenesis, ribosome matur factor, ribosome; 8.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3q6d_A Proline dipeptidase; structural genomics, csgid, center for structural genomics O infectious diseases, aminopeptidase, viral protein; 1.97A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4ege_A Dipeptidase PEPE; structural genomics, seattle structural genomics center for infectious disease, ssgcid, hydrolase; 2.20A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >2zsg_A Aminopeptidase P, putative; hydrolase; 1.65A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1wy2_A XAA-Pro dipeptidase; structural genomics, prolidase, riken structural genomics/PR initiative, RSGI, hydrolase; 1.70A {Pyrococcus horikoshii} PDB: 1pv9_A | Back alignment and structure |
|---|
| >1wn1_A Dipeptidase; prolidase, cobalt(II), structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; 2.25A {Pyrococcus horikoshii} PDB: 2how_A | Back alignment and structure |
|---|
| >1o0x_A Methionine aminopeptidase; TM1478, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Thermotoga maritima} SCOP: d.127.1.1 | Back alignment and structure |
|---|
| >2gg2_A Methionine aminopeptidase; PITA-bread fold, MAP inhibitor, antibacterial, hydrolase; HET: U12; 1.00A {Escherichia coli K12} SCOP: d.127.1.1 PDB: 2gg0_A* 2gg3_A* 2gg5_A* 2gg7_A* 2gg8_A* 2gg9_A* 2ggb_A* 2ggc_A 2q93_A* 2q95_A* 2q96_A* 1xnz_A* 1mat_A* 2bb7_A* 2evc_A* 2evm_A* 2evo_A* 3mat_A* 1yvm_A* 2mat_A ... | Back alignment and structure |
|---|
| >3mx6_A Methionine aminopeptidase; seattle structural genomics center for infectious disease, S aminopeptidase, protease, epidermic typhus; 1.70A {Rickettsia prowazekii} PDB: 3mr1_A | Back alignment and structure |
|---|
| >1qxy_A Methionyl aminopeptidase; PITA bread fold, hydrolase; HET: M2C; 1.04A {Staphylococcus aureus} SCOP: d.127.1.1 PDB: 1qxw_A* 1qxz_A* | Back alignment and structure |
|---|
| >4fkc_A XAA-Pro aminopeptidase; PITA-bread structure, prolidase, hydrolase; 2.60A {Thermococcus sibiricus} | Back alignment and structure |
|---|
| >3pka_A Methionine aminopeptidase; hydrolase-hydrolase inhibitor complex; HET: Y02; 1.25A {Mycobacterium tuberculosis} PDB: 3pkb_A* 3pkc_A* 3pkd_A* 3pke_A* 3iu7_A* 3iu8_A* 3iu9_A* 1y1n_A 1yj3_A 3ror_A | Back alignment and structure |
|---|
| >3cb6_A FACT complex subunit SPT16; peptidase homology domain, histone binding module, histone H chaperone, PITA-bread fold; 1.84A {Schizosaccharomyces pombe} PDB: 3cb5_A | Back alignment and structure |
|---|
| >1kp0_A Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sandwich; 2.70A {Actinobacillus} SCOP: c.55.2.1 d.127.1.1 | Back alignment and structure |
|---|
| >3tb5_A Methionine aminopeptidase; hydrolase, metalloprotease, enter feacalis; HET: CIT; 2.30A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3biq_A FACT complex subunit SPT16; PITA-bread, aminopeptidase, chromatin, replication, AC chromosomal protein, DNA damage, DNA repair; 1.73A {Saccharomyces cerevisiae} PDB: 3bip_A 3bit_A* | Back alignment and structure |
|---|
| >3tav_A Methionine aminopeptidase; ssgcid, seattle structural genomics center for infectious DI protease, hydrolase; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3ig4_A XAA-Pro aminopeptidase; csgid, hydrolase, struct genomics, center for structural genomics of infectious DISE; HET: SO4; 2.89A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1chm_A Creatine amidinohydrolase; creatinase; 1.90A {Pseudomonas putida} SCOP: c.55.2.1 d.127.1.1 | Back alignment and structure |
|---|
| >1xgs_A Methionine aminopeptidase; hyperthermophIle; 1.75A {Pyrococcus furiosus} SCOP: a.4.5.25 d.127.1.1 PDB: 1xgm_A 1xgn_A 1xgo_A 1wkm_A 2dfi_A | Back alignment and structure |
|---|
| >2v3z_A XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- specific enzyme, aminopeptidas manganese enzyme, protease, manganese; HET: CSO; 1.56A {Escherichia coli} SCOP: c.55.2.1 d.127.1.1 PDB: 2bwy_A* 1wl9_A 1m35_A 1n51_A* 1w2m_A 1a16_A 1wbq_A 1wl6_A* 1w7v_A 1wlr_A* 2bh3_A* 2bha_A* 2bhb_A* 2bhc_A* 2bhd_A* 2bn7_A* 1jaw_A 2bwt_A* 2bwu_A* 2bww_A* ... | Back alignment and structure |
|---|
| >3s6b_A Methionine aminopeptidase; malaria, proteolysis, "PITA bread" fold, structur genomics, structural genomics consortium, SGC, hydrolase; 1.95A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2b3h_A Methionine aminopeptidase 1; hydrolase, metalloprotease, pitab; HET: GOL; 1.10A {Homo sapiens} PDB: 2b3k_A 2b3l_A 2gz5_A* 2nq6_A* 2nq7_A* 2g6p_A* | Back alignment and structure |
|---|
| >2q8k_A Proliferation-associated protein 2G4; EBP1, PA2G4, methionine aminopeptidase, PITA-bread, transcri; 1.60A {Homo sapiens} PDB: 2v6c_A | Back alignment and structure |
|---|
| >3rva_A Organophosphorus acid anhydrolase; PITA-bread fold, binuclea center, BI-functional, prolidase, nerve agents, XAA-Pro DIP hydrolase; 1.80A {Alteromonas macleodii} | Back alignment and structure |
|---|
| >3ctz_A XAA-Pro aminopeptidase 1; PITA-bread fold, alternative splicing, cytoplasm, hydrolase, manganese, metal-binding, metalloprotease, protease; HET: P6G; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3l24_A XAA-Pro dipeptidase; PITA-bread, detoxification, hydrolase, manganese, metal-binding, metalloprotease, protease; 2.30A {Alteromonas SP} PDB: 3l7g_A* | Back alignment and structure |
|---|
| >4fuk_A Methionine aminopeptidase; structural genomics consortium, SGC, hydrolase; 1.75A {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >4b28_A Metallopeptidase, family M24, putative; lyase, imethylsulfonioproionate, acrylate, dimethylsulfide; 2.15A {Roseobacter denitrificans och 114} | Back alignment and structure |
|---|
| >1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* | Back alignment and structure |
|---|
| >2iw2_A XAA-Pro dipeptidase; metallocarboxypeptidase, disease mutation, XAA-Pro dipeptida dipeptidase, peptidase D, collagen degradation; 1.82A {Homo sapiens} PDB: 2okn_A | Back alignment and structure |
|---|
| >3fm3_A Methionine aminopeptidase 2; metap2, structural genomics, PSI-2, protein structure initiative; 2.18A {Encephalitozoon cuniculi} PDB: 3fmq_A* 3fmr_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 234 | ||||
| d2gg2a1 | 262 | d.127.1.1 (A:3-264) Methionine aminopeptidase {Esc | 9e-28 | |
| d1b6aa2 | 295 | d.127.1.1 (A:110-374,A:449-478) Methionine aminope | 9e-21 | |
| d1qxya_ | 249 | d.127.1.1 (A:) Methionine aminopeptidase {Staphylo | 2e-17 | |
| d2v3za2 | 264 | d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal | 3e-16 | |
| d1chma2 | 246 | d.127.1.1 (A:157-402) Creatinase, catalytic (C-ter | 5e-16 | |
| d1xgsa2 | 218 | d.127.1.1 (A:1-194,A:272-295) Methionine aminopept | 2e-15 | |
| d1o0xa_ | 249 | d.127.1.1 (A:) Methionine aminopeptidase {Thermoto | 4e-15 | |
| d1pv9a2 | 221 | d.127.1.1 (A:125-345) Aminopeptidase P, C-terminal | 2e-11 |
| >d2gg2a1 d.127.1.1 (A:3-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} Length = 262 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Creatinase/aminopeptidase superfamily: Creatinase/aminopeptidase family: Creatinase/aminopeptidase domain: Methionine aminopeptidase species: Escherichia coli [TaxId: 562]
Score = 104 bits (260), Expect = 9e-28
Identities = 58/115 (50%), Positives = 79/115 (68%), Gaps = 2/115 (1%)
Query: 109 EVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMII-DNGAYPSPLGYG 167
+ + IE MRV+GRLAA+VLE VKPG++T E+D+ + I+ + A + LGY
Sbjct: 2 SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYH 61
Query: 168 GFPKSVCTSVNECICHGIP-DSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDV 221
G+PKSVC S+NE +CHGIP D++ L+DGD +NIDVTV +G+HGDTS F G
Sbjct: 62 GYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKP 116
|
| >d1b6aa2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]} Length = 295 | Back information, alignment and structure |
|---|
| >d1qxya_ d.127.1.1 (A:) Methionine aminopeptidase {Staphylococcus aureus [TaxId: 1280]} Length = 249 | Back information, alignment and structure |
|---|
| >d2v3za2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 264 | Back information, alignment and structure |
|---|
| >d1chma2 d.127.1.1 (A:157-402) Creatinase, catalytic (C-terminal) domain {Pseudomonas putida [TaxId: 303]} Length = 246 | Back information, alignment and structure |
|---|
| >d1xgsa2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 218 | Back information, alignment and structure |
|---|
| >d1o0xa_ d.127.1.1 (A:) Methionine aminopeptidase {Thermotoga maritima [TaxId: 2336]} Length = 249 | Back information, alignment and structure |
|---|
| >d1pv9a2 d.127.1.1 (A:125-345) Aminopeptidase P, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 221 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 234 | |||
| d1qxya_ | 249 | Methionine aminopeptidase {Staphylococcus aureus [ | 99.95 | |
| d1o0xa_ | 249 | Methionine aminopeptidase {Thermotoga maritima [Ta | 99.94 | |
| d1pv9a2 | 221 | Aminopeptidase P, C-terminal domain {Archaeon Pyro | 99.94 | |
| d2gg2a1 | 262 | Methionine aminopeptidase {Escherichia coli [TaxId | 99.93 | |
| d1chma2 | 246 | Creatinase, catalytic (C-terminal) domain {Pseudom | 99.93 | |
| d2v3za2 | 264 | Aminopeptidase P, C-terminal domain {Escherichia c | 99.93 | |
| d1b6aa2 | 295 | Methionine aminopeptidase {Human (Homo sapiens) [T | 99.9 | |
| d1xgsa2 | 218 | Methionine aminopeptidase {Archaeon Pyrococcus fur | 99.87 | |
| d1pv9a2 | 221 | Aminopeptidase P, C-terminal domain {Archaeon Pyro | 97.67 | |
| d1xgsa2 | 218 | Methionine aminopeptidase {Archaeon Pyrococcus fur | 97.17 | |
| d2gg2a1 | 262 | Methionine aminopeptidase {Escherichia coli [TaxId | 97.02 | |
| d1chma2 | 246 | Creatinase, catalytic (C-terminal) domain {Pseudom | 96.98 | |
| d1qxya_ | 249 | Methionine aminopeptidase {Staphylococcus aureus [ | 96.62 | |
| d1o0xa_ | 249 | Methionine aminopeptidase {Thermotoga maritima [Ta | 96.46 | |
| d2v3za2 | 264 | Aminopeptidase P, C-terminal domain {Escherichia c | 95.28 | |
| d1b6aa2 | 295 | Methionine aminopeptidase {Human (Homo sapiens) [T | 92.36 |
| >d1qxya_ d.127.1.1 (A:) Methionine aminopeptidase {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Creatinase/aminopeptidase superfamily: Creatinase/aminopeptidase family: Creatinase/aminopeptidase domain: Methionine aminopeptidase species: Staphylococcus aureus [TaxId: 1280]
Probab=99.95 E-value=5.2e-28 Score=206.38 Aligned_cols=126 Identities=33% Similarity=0.591 Sum_probs=117.1
Q ss_pred CccCCHHHHHHHHHHHHHHHHHHHHHhhhcCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCeeeecCCCceeccCCC
Q 026748 108 PEVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPD 187 (234)
Q Consensus 108 R~VKs~eEIe~mR~Aa~ia~~al~~~~~~ikpGvTe~EI~~~v~~~l~~~Ga~ps~l~y~gFp~~v~sg~N~~~~Hg~P~ 187 (234)
.+|||++||+.||+|++|++++++++.+.++||+||.||++.+++.+.++|+.+++.++.+|+.++|+|.|+..+|+.|+
T Consensus 1 ~~IKs~~Ei~~~R~A~~i~~~~~~~~~~~i~~G~se~ei~~~~~~~~~~~~a~~~~~~~~~~~~~~~~g~~~~~~h~~~~ 80 (249)
T d1qxya_ 1 MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPS 80 (249)
T ss_dssp CBCCSHHHHHHHHHHHHHHHHHHHHHHHHCCTTCBHHHHHHHHHHHHHHHTCEEHHHHHHCCSSSSEEEETTEEECCCCC
T ss_pred CEeCCHHHHHHHHHHHHHHHHHHHHHHHHCcCCCcHHHHHHHHHHHHHHhhhhhcccccccccccccccccccccccccC
Confidence 37999999999999999999999999999999999999999999999999998765556779999999999999999999
Q ss_pred CCCCCCCCEEEEEEeeEECCEEeceeeEEEcCCCC-HHHHHHHhhhc
Q 026748 188 SRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVD-DEARNLVKGPC 233 (234)
Q Consensus 188 ~r~L~~GDiV~iDvg~~~~GY~~D~sRTf~VG~~s-~e~~~l~e~~~ 233 (234)
+++|++||+|++|+++.++||++|++|||++|+++ +++++++++++
T Consensus 81 ~~~l~~Gd~v~id~g~~~~gY~~d~~Rt~~~G~~~~~~~~~~~~~~~ 127 (249)
T d1qxya_ 81 KRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCDVAT 127 (249)
T ss_dssp SCBCCTTCEEEEEEEEEETTEEEEEEEEEECSCCSCTHHHHHHHHHH
T ss_pred CceecCCCceEEeeeeEECCEecccccccccCCCcchhhhHHHHHHH
Confidence 99999999999999999999999999999999875 46777888765
|
| >d1o0xa_ d.127.1.1 (A:) Methionine aminopeptidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pv9a2 d.127.1.1 (A:125-345) Aminopeptidase P, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2gg2a1 d.127.1.1 (A:3-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1chma2 d.127.1.1 (A:157-402) Creatinase, catalytic (C-terminal) domain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2v3za2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b6aa2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xgsa2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1pv9a2 d.127.1.1 (A:125-345) Aminopeptidase P, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1xgsa2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2gg2a1 d.127.1.1 (A:3-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1chma2 d.127.1.1 (A:157-402) Creatinase, catalytic (C-terminal) domain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1qxya_ d.127.1.1 (A:) Methionine aminopeptidase {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1o0xa_ d.127.1.1 (A:) Methionine aminopeptidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2v3za2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b6aa2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|