Citrus Sinensis ID: 026750

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
MSVSLNANLYQPSLSCNLKLFSGLKIQSPSVFGTGKPNLSAEFYGRVHKSLYSGIRNDKPIRGRIAMMPIGTPKVLYRTPGEGSWQWVDLWNALYRERVIFIGQNIDEEFSNQILATMLYLDSVDDSKRVYMYINGPGGDVTPTLAIYDTMQSLKSPVGTHCVGFAYHLAGFLLAGGEKGNRSAMPLSRIALDSPAGAARGQADDIRNEADELLRVRDYIFKELSRKTDYEGFK
cccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEEECccccccccHHHHHHHHHHccEEEccccccHHHHHHHHHHHHHHccccccccEEEEEEcccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccEEECcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
********LYQPSLSCNLKLFSGLKIQSPSVFGTGKPNLSAEFYGRVHKSLYSGIRN***IRGRIAMMPIGTPKVLYRTPGEGSWQWVDLWNALYRERVIFIGQNIDEEFSNQILATMLYLDSVDDSKRVYMYINGPGGDVTPTLAIYDTMQSLKSPVGTHCVGFAYHLAGFLLAGGEKGNRSAMPLSRIALDSPAGAARGQADDIRNEADELLRVRDYIFKELSRKT******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVSLNANLYQPSLSCNLKLFSGLKIQSPSVFGTGKPNLSAEFYGRVHKSLYSGIRNDKPIRGRIAMMPIGTPKVLYRTPGEGSWQWVDLWNALYRERVIFIGQNIDEEFSNQILATMLYLDSVDDSKRVYMYINGPGGDVTPTLAIYDTMQSLKSPVGTHCVGFAYHLAGFLLAGGEKGNRSAMPLSRIALDSPAGAARGQADDIRNEADELLRVRDYIFKELSRKTDYEGFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent Clp protease proteolytic subunit-related protein 2, chloroplastic Required for chloroplast development and integrity. Involved in the regulation of plastoglobules formation.confidentQ9XJ36
ATP-dependent Clp protease proteolytic subunit 2 Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.probableQ8DJZ9
Probable ATP-dependent Clp protease proteolytic subunit 3 Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.probableQ8YP43

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.21.-Serine endopeptidases.probable
3.4.21.92Endopeptidase Clp.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QWD, chain A
Confidence level:very confident
Coverage over the Query: 72-233
View the alignment between query and template
View the model in PyMOL