Citrus Sinensis ID: 026754


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
MEAAMGLMRRMPPKHSETALSALLSLLPDHSSDLLSQVDQPLQVLFDEESGKEFILCEYNRDADSYRSPWSNKYHPPLEDALYPPAELRKLEIEANEVFAIYRDQYYEGGISSVYMWEDDNEGFVACFLIKKDGSKTAQGRRGHLEEGAWDAIHVIEVAPEEEGIARYCLTSTVMLSLTTDHESSGTFSLSGSIRRQVICHLNCYGVMFFETSWRMEFSCRLFSLRINNSCVQ
cHHHHHHHcccccccHHHHHHHHHccccccHHHHHHcccccCEEEEEcccccEEEECccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccEEEEEEEEEccccccccccccccccccccEEEEEEEcccccEEEEEEEEEEEEEEEEccccccEEEEccEEHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccc
MEAAMGLMRRMPPKHSETALSALLSLLPDHSSDLLSQVDQPLQVLFDEESGKEFILCEYNRDADSYRSPWSNKYHPPLEDALYPPAELRKLEIEANEVFAIYRDQYYEGGISSVYMWEDDNEGFVACFLIKKDG************EGAWDAIHVIEVAPEEEGIARYCLTSTVMLSLTTD*********SGSIRRQVICHLNCYGVMFFETSWRMEFSCRLFSLRINNS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAAMGLMRRMPPKHSETALSALLSLLPDHSSDLLSQVDQPLQVLFDEESGKEFILCEYNRDADSYRSPWSNKYHPPLEDALYPPAELRKLEIEANEVFAIYRDQYYEGGISSVYMWEDDNEGFVACFLIKKDGSKTAQGRRGHLEEGAWDAIHVIEVAPEEEGIARYCLTSTVMLSLTTDHESSGTFSLSGSIRRQVICHLNCYGVMFFETSWRMEFSCRLFSLRINNSCVQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable F-actin-capping protein subunit beta F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.probableQ9M9G7
F-actin-capping protein subunit beta F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.probableP13021
F-actin-capping protein subunit beta F-actin-capping proteins bind in a Ca(2+)-independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments.probableP34686

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AKR, chain B
Confidence level:very confident
Coverage over the Query: 1-223
View the alignment between query and template
View the model in PyMOL