Citrus Sinensis ID: 026765


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
MGESSIPFKNLHSREYTGHKKKVHSVAWNCTGTKLASGSVDQTARVWHIEPHGHGKVKDIELRGHADSVDQLCWDPKHADLIATASGDKTVRLWDARSGKCSQQAELSGENINITYKPDGTHIAVGNRDDELTILDVRKFKPIHRRKFGYEVNEIAWNMTGEMFFLTTGNGTVEVLTYPSLRPLDTVVAHTAGCYCIAIDPMGRYFAVGSADSLVSLWDISEMLCVRTFTKLE
cccccEEEEEccccEEccccccEEEEEEcccccEEEEccccccEEEEEccccccccEEccccccccccEEEEEEccccccEEEEccccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEccccCEEEEcccccCEEEEEEcccccEEEEECccccEEEEEccccccEEEEccccccEEEEEEcccccEEEEECccccEEEEEccccEEEccccccc
*GESSIPFKNLHSREYTGHKKKVHSVAWNCTGTKLASGSVDQTARVWHIEPHGHGKVKDIELRGHADSVDQLCWDPKHADLIATASGDKTVRLWDARSGKCSQQAELSGENINITYKPDGTHIAVGNRDDELTILDVRKFKPIHRRKFGYEVNEIAWNMTGEMFFLTTGNGTVEVLTYPSLRPLDTVVAHTAGCYCIAIDPMGRYFAVGSADSLVSLWDISEMLCVRTFT***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGESSIPFKNLHSREYTGHKKKVHSVAWNCTGTKLASGSVDQTARVWHIEPHGHGKVKDIELRGHADSVDQLCWDPKHADLIATASGDKTVRLWDARSGKCSQQAELSGENINITYKPDGTHIAVGNRDDELTILDVRKFKPIHRRKFGYEVNEIAWNMTGEMFFLTTGNGTVEVLTYPSLRPLDTVVAHTAGCYCIAIDPMGRYFAVGSADSLVSLWDISEMLCVRTFTKLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
THO complex subunit 3 Component of the THO subcomplex of the TREX complex. The TREX complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export. The recruitment occurs via an interaction between ALYREF/THOC4 and the cap-binding protein NCBP1. DDX39B functions as a bridge between ALYREF/THOC4 and the THO complex.probableQ29RH4
THO complex subunit 3 Component of the THO subcomplex of the TREX complex. The TREX complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export. The recruitment occurs via an interaction between ALYREF/THOC4 and the cap-binding protein NCBP1. DDX39B functions as a bridge between ALYREF/THOC4 and the THO complex.The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. The recruitment of the TREX complex to the intronless viral mRNA occurs via an interaction between KSHV ORF57 protein and ALYREF/THOC4.probableQ96J01
THO complex subunit 3 Component of the THO subcomplex of the TREX complex. The TREX complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export. The recruitment occurs via an interaction between ALYREF/THOC4 and the cap-binding protein NCBP1. DDX39B functions as a bridge between ALYREF/THOC4 and the THO complex.probableQ8VE80

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SFZ, chain A
Confidence level:very confident
Coverage over the Query: 10-232
View the alignment between query and template
View the model in PyMOL