Citrus Sinensis ID: 026828


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MQPISGYGVAKVLDSENPEFNKGDLVWGMTGWEEYSLITAPHLFKIQHTDVPLSYYTGILGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGVHNLMYLLGNEFAWKDFLPVISTTNIRNSWNWLCRQSKKES
cccEEcccEEEEEEccccccccccEEEEccccEEEEEEcccccEEccccccccHHHHcccccccHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHcccEEEcccccccHHHHHHHHccccccEEEcccccHHHHHHHHHHHcccEEEEEccccccccccccccccHHHHHHHHEEEEEEEccccHHHHHHHHHHHHccccccc
ccEEEEcEEEEEEEccccccccccEEEEccccEEEEEEccccEEEcccccccHHHHHHHcccccHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHccccHHEccHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHcccccEEEEHHEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEc
mqpisgygvakvldsenpefnkgdlvwgmtgweeyslitaphlfkiqhtdvplsyytgilgmpgmtAYVGFyevcspkhgecvfisaasGAVGQLVGQFAKLLGCYvvgsagskdkVDLLKnkfgfdeafnYKEEADLNAALKRYFPEGIDIYFENVggklldavlpnmkiRGRIAACGMisqynldkpegVHNLMYLLGNefawkdflpvisttnirnswNWLCRQSKKES
mqpisgygvakvldsenpefNKGDLVWGMTGWEEYSLITAPHLFKIQHTDVPLSYYTGILGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGVHNLMYLLGNEFAWKDFLPVISTtnirnswnwlcrqskkes
MQPISGYGVAKVLDSENPEFNKGDLVWGMTGWEEYSLITAPHLFKIQHTDVPLSYYTGILGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGVHNLMYLLGNEFAWKDFLPVISTTNIRNSWNWLCRQSKKES
***********V******EFNKGDLVWGMTGWEEYSLITAPHLFKIQHTDVPLSYYTGILGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGVHNLMYLLGNEFAWKDFLPVISTTNIRNSWNWLCR******
MQPISGYGVAKVLDSENPEFNKGDLVWGMTGWEEYSLITAPHLFKIQHTDVPLSYYTGILGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGVHNLMYLLGNEFAWKDFLPVISTTNIRNSWNWLCRQSK***
MQPISGYGVAKVLDSENPEFNKGDLVWGMTGWEEYSLITAPHLFKIQHTDVPLSYYTGILGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGVHNLMYLLGNEFAWKDFLPVISTTNIRNSWNWLCRQSKKES
MQPISGYGVAKVLDSENPEFNKGDLVWGMTGWEEYSLITAPHLFKIQHTDVPLSYYTGILGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGVHNLMYLLGNEFAWKDFLPVISTTNIRNSWNWLCRQSKKES
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQPISGYGVAKVLDSENPEFNKGDLVWGMTGWEEYSLITAPHLFKIQHTDVPLSYYTGILGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGVHNLMYLLGNEFAWKDFLPVISTTNIRNSWNWLCRQSKKES
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
Q39172345 NADP-dependent alkenal do no no 0.896 0.602 0.719 2e-86
Q39173343 NADP-dependent alkenal do no no 0.896 0.606 0.723 2e-86
Q6WAU0342 (+)-pulegone reductase OS N/A no 0.896 0.608 0.690 2e-84
Q91YR9329 Prostaglandin reductase 1 yes no 0.788 0.556 0.502 1e-42
Q9C0Y6349 Zinc-type alcohol dehydro yes no 0.887 0.590 0.452 4e-42
O34812339 Putative NADP-dependent o yes no 0.788 0.539 0.467 3e-41
P97584329 Prostaglandin reductase 1 yes no 0.788 0.556 0.486 5e-41
Q29073329 Prostaglandin reductase 1 yes no 0.771 0.544 0.491 7e-41
Q9EQZ5329 Prostaglandin reductase 1 yes no 0.771 0.544 0.497 9e-41
Q3SZJ4329 Prostaglandin reductase 1 yes no 0.788 0.556 0.486 2e-40
>sp|Q39172|P1_ARATH NADP-dependent alkenal double bond reductase P1 OS=Arabidopsis thaliana GN=P1 PE=1 SV=1 Back     alignment and function desciption
 Score =  318 bits (815), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 151/210 (71%), Positives = 177/210 (84%), Gaps = 2/210 (0%)

Query: 2   QPISGYGVAKVLDSENPEFNKGDLVWGMTGWEEYSLITA-PHL-FKIQHTDVPLSYYTGI 59
           QPI GYGV+++++S +P++ KGDL+WG+  WEEYS+IT   H  FKIQHTDVPLSYYTG+
Sbjct: 76  QPIQGYGVSRIIESGHPDYKKGDLLWGIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGL 135

Query: 60  LGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDL 119
           LGMPGMTAY GFYEVCSPK GE V++SAASGAVGQLVGQ AK++GCYVVGSAGSK+KVDL
Sbjct: 136 LGMPGMTAYAGFYEVCSPKEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDL 195

Query: 120 LKNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACG 179
           LK KFGFD+AFNYKEE+DL AALKR FP GIDIYFENVGGK+LDAVL NM + GRIA CG
Sbjct: 196 LKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCG 255

Query: 180 MISQYNLDKPEGVHNLMYLLGNEFAWKDFL 209
           MISQYNL+  EGVHNL  ++      + F+
Sbjct: 256 MISQYNLENQEGVHNLSNIIYKRIRIQGFV 285




Catalyzes the reduction of the 7-8 double bond of phenylpropanal substrates, such as p-coumaryl aldehyde and coniferyl aldehyde (in vitro). Has activity towards toxic substrates, such as 4-hydroxy-(2E)-nonenal (in vitro). May play a distinct role in plant antioxidant defense and is possibly involved in NAD(P)/NAD(P)H homeostasis.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 3EC: .EC: 1EC: .EC: 7EC: 4
>sp|Q39173|P2_ARATH NADP-dependent alkenal double bond reductase P2 OS=Arabidopsis thaliana GN=P2 PE=2 SV=2 Back     alignment and function description
>sp|Q6WAU0|PULR_MENPI (+)-pulegone reductase OS=Mentha piperita PE=1 SV=1 Back     alignment and function description
>sp|Q91YR9|PTGR1_MOUSE Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1 PE=2 SV=2 Back     alignment and function description
>sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 Back     alignment and function description
>sp|O34812|YFMJ_BACSU Putative NADP-dependent oxidoreductase YfmJ OS=Bacillus subtilis (strain 168) GN=yfmJ PE=2 SV=1 Back     alignment and function description
>sp|P97584|PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 Back     alignment and function description
>sp|Q29073|PTGR1_PIG Prostaglandin reductase 1 OS=Sus scrofa GN=PTGR1 PE=1 SV=1 Back     alignment and function description
>sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 Back     alignment and function description
>sp|Q3SZJ4|PTGR1_BOVIN Prostaglandin reductase 1 OS=Bos taurus GN=PTGR1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
224117874 348 predicted protein [Populus trichocarpa] 0.896 0.597 0.794 3e-93
224117858 348 predicted protein [Populus trichocarpa] 0.896 0.597 0.789 6e-93
342898879 348 ketone/zingerone synthase 1 [Rubus idaeu 0.892 0.594 0.788 6e-93
225434189 345 PREDICTED: NADP-dependent alkenal double 0.892 0.6 0.798 1e-92
342898881 352 ketone/zingerone synthase 2 [Rubus idaeu 0.887 0.585 0.789 5e-92
224092848 348 predicted protein [Populus trichocarpa] 0.853 0.568 0.829 4e-91
444302246 351 Chain A, X-ray Crystal Structure Of A Do 0.892 0.589 0.788 6e-91
224092856 345 predicted protein [Populus trichocarpa] 0.896 0.602 0.770 6e-91
6692816 343 allyl alcohol dehydrogenase [Nicotiana t 0.892 0.603 0.788 7e-91
225434197 345 PREDICTED: NADP-dependent alkenal double 0.887 0.597 0.787 1e-90
>gi|224117874|ref|XP_002331653.1| predicted protein [Populus trichocarpa] gi|222874049|gb|EEF11180.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 185/209 (88%), Gaps = 1/209 (0%)

Query: 2   QPISGYGVAKVLDSENPEFNKGDLVWGMTGWEEYSLITAPH-LFKIQHTDVPLSYYTGIL 60
            PISG GVAKVLDS +P++ KGD +WG+TGWEEYSLITA   LFKI   DVPLSYYTGIL
Sbjct: 80  SPISGRGVAKVLDSRHPDYKKGDFIWGITGWEEYSLITATETLFKIHDKDVPLSYYTGIL 139

Query: 61  GMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLL 120
           GMPGMTAY GFYE+CSPK GE VFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLL
Sbjct: 140 GMPGMTAYAGFYEICSPKKGEFVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLL 199

Query: 121 KNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGM 180
           KNKFGFD+AFNYKEE DL+AALKRYFP+GIDIYFENVGGK+LDAVL NM++RGRI+ CGM
Sbjct: 200 KNKFGFDDAFNYKEELDLDAALKRYFPDGIDIYFENVGGKILDAVLLNMRVRGRISVCGM 259

Query: 181 ISQYNLDKPEGVHNLMYLLGNEFAWKDFL 209
           +SQYNL++PEGVHNLM+L+      + FL
Sbjct: 260 VSQYNLEQPEGVHNLMHLVLKRIHMEGFL 288




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224117858|ref|XP_002331649.1| predicted protein [Populus trichocarpa] gi|222874045|gb|EEF11176.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|342898879|gb|AEL78825.1| ketone/zingerone synthase 1 [Rubus idaeus] Back     alignment and taxonomy information
>gi|225434189|ref|XP_002279359.1| PREDICTED: NADP-dependent alkenal double bond reductase P2 [Vitis vinifera] gi|147792339|emb|CAN61471.1| hypothetical protein VITISV_043825 [Vitis vinifera] Back     alignment and taxonomy information
>gi|342898881|gb|AEL78826.1| ketone/zingerone synthase 2 [Rubus idaeus] Back     alignment and taxonomy information
>gi|224092848|ref|XP_002309722.1| predicted protein [Populus trichocarpa] gi|118483208|gb|ABK93507.1| unknown [Populus trichocarpa] gi|222852625|gb|EEE90172.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|444302246|pdb|4HFJ|A Chain A, X-ray Crystal Structure Of A Double Bond Reductase From Nicotiana Tabacum gi|444302247|pdb|4HFJ|B Chain B, X-ray Crystal Structure Of A Double Bond Reductase From Nicotiana Tabacum gi|444302248|pdb|4HFM|A Chain A, X-ray Crystal Structure Of A Nadp(h)-bound Double Bond Reductase From Nicotiana Tabacum gi|444302249|pdb|4HFM|B Chain B, X-ray Crystal Structure Of A Nadp(h)-bound Double Bond Reductase From Nicotiana Tabacum gi|444302250|pdb|4HFN|A Chain A, X-ray Crystal Structure Of A Ternary Complex Of Double Bond Reductase From Nicotiana Tabacum gi|444302251|pdb|4HFN|B Chain B, X-ray Crystal Structure Of A Ternary Complex Of Double Bond Reductase From Nicotiana Tabacum Back     alignment and taxonomy information
>gi|224092856|ref|XP_002309725.1| predicted protein [Populus trichocarpa] gi|222852628|gb|EEE90175.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|6692816|dbj|BAA89423.1| allyl alcohol dehydrogenase [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|225434197|ref|XP_002279529.1| PREDICTED: NADP-dependent alkenal double bond reductase P2 [Vitis vinifera] gi|147783628|emb|CAN68149.1| hypothetical protein VITISV_035666 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
TAIR|locus:2028736351 AT1G26320 [Arabidopsis thalian 0.849 0.561 0.778 1e-82
TAIR|locus:2097795350 AT3G03080 [Arabidopsis thalian 0.896 0.594 0.736 1.3e-82
TAIR|locus:2148166343 AT5G16990 [Arabidopsis thalian 0.853 0.577 0.755 7.4e-82
TAIR|locus:2148131345 AER "alkenal reductase" [Arabi 0.853 0.573 0.75 1.5e-81
TAIR|locus:2148186345 AT5G17000 [Arabidopsis thalian 0.853 0.573 0.75 4.1e-81
TAIR|locus:2153799353 AT5G37940 [Arabidopsis thalian 0.905 0.594 0.716 4.1e-81
TAIR|locus:2153759353 AT5G37980 [Arabidopsis thalian 0.905 0.594 0.726 4.1e-81
TAIR|locus:2148116346 AT5G16960 [Arabidopsis thalian 0.836 0.560 0.755 1.2e-79
UNIPROTKB|Q6WAU0342 Q6WAU0 "(+)-pulegone reductase 0.896 0.608 0.690 2e-79
TAIR|locus:2154041353 AT5G38000 [Arabidopsis thalian 0.905 0.594 0.698 6.8e-79
TAIR|locus:2028736 AT1G26320 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 829 (296.9 bits), Expect = 1.0e-82, P = 1.0e-82
 Identities = 155/199 (77%), Positives = 174/199 (87%)

Query:     3 PISGYGVAKVLDSENPEFNKGDLVWGMTGWEEYSLITAPHL--FKIQHTDVPLSYYTGIL 60
             PI G GV+KV+DS +P++ KGDL+WG+ GWEEYS+IT      FKI+HTDVPLSYYTG+L
Sbjct:    83 PIIGLGVSKVIDSGHPDYKKGDLLWGLVGWEEYSVITLTTYSHFKIEHTDVPLSYYTGLL 142

Query:    61 GMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLL 120
             GMPGMTAY GFYEVCSPK GE VF+SAASGAVGQLVGQFAKL+GCYVVGSAGSK+KV LL
Sbjct:   143 GMPGMTAYAGFYEVCSPKKGETVFVSAASGAVGQLVGQFAKLMGCYVVGSAGSKEKVYLL 202

Query:   121 KNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGM 180
             K KFGFD+AFNYKEE D +AALKRYFPEGIDIYFENVGGK+LDAVL NMK+ GR+A CGM
Sbjct:   203 KTKFGFDDAFNYKEEKDFSAALKRYFPEGIDIYFENVGGKMLDAVLINMKLHGRVAVCGM 262

Query:   181 ISQYNLDKPEGVHNLMYLL 199
             ISQYNL  PEGVHNL  +L
Sbjct:   263 ISQYNLVDPEGVHNLPTIL 281




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006979 "response to oxidative stress" evidence=IEP
TAIR|locus:2097795 AT3G03080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148166 AT5G16990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148131 AER "alkenal reductase" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148186 AT5G17000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153799 AT5G37940 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153759 AT5G37980 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2148116 AT5G16960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6WAU0 Q6WAU0 "(+)-pulegone reductase" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
TAIR|locus:2154041 AT5G38000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.3.10.921
3rd Layer1.3.1.81LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
cd08295338 cd08295, double_bond_reductase_like, Arabidopsis a 1e-144
PLN03154348 PLN03154, PLN03154, putative allyl alcohol dehydro 1e-112
cd05288329 cd05288, PGDH, Prostaglandin dehydrogenases 1e-105
COG2130340 COG2130, COG2130, Putative NADP-dependent oxidored 7e-86
cd08294329 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifun 4e-75
TIGR02825325 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehy 4e-56
cd08293345 cd08293, PTGR2, Prostaglandin reductase 4e-45
cd08250329 cd08250, Mgc45594_like, Mgc45594 gene product and 8e-38
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 9e-27
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 2e-24
cd08253325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 2e-22
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 6e-20
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 5e-19
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 3e-18
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 5e-17
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 1e-16
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 7e-16
cd08271325 cd08271, MDR5, Medium chain dehydrogenases/reducta 9e-16
cd08272326 cd08272, MDR6, Medium chain dehydrogenases/reducta 1e-15
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 1e-15
cd05280325 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ 3e-14
cd08275337 cd08275, MDR3, Medium chain dehydrogenases/reducta 7e-14
TIGR02823323 TIGR02823, oxido_YhdH, putative quinone oxidoreduc 2e-12
TIGR02824325 TIGR02824, quinone_pig3, putative NAD(P)H quinone 4e-11
cd08268328 cd08268, MDR2, Medium chain dehydrogenases/reducta 4e-11
cd05195293 cd05195, enoyl_red, enoyl reductase of polyketide 4e-11
cd08244324 cd08244, MDR_enoyl_red, Possible enoyl reductase 2e-10
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 1e-09
smart00829287 smart00829, PKS_ER, Enoylreductase 1e-09
PTZ00354334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi 2e-09
cd08276336 cd08276, MDR7, Medium chain dehydrogenases/reducta 2e-09
cd08290341 cd08290, ETR, 2-enoyl thioester reductase (ETR) 4e-09
cd08264325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t 4e-09
cd08274350 cd08274, MDR9, Medium chain dehydrogenases/reducta 5e-09
cd08251303 cd08251, polyketide_synthase, polyketide synthase 8e-09
cd08249339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 1e-08
cd08255277 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro 3e-08
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 6e-08
cd08289326 cd08289, MDR_yhfp_like, Yhfp putative quinone oxid 1e-07
cd08273331 cd08273, MDR8, Medium chain dehydrogenases/reducta 1e-07
cd08270305 cd08270, MDR4, Medium chain dehydrogenases/reducta 2e-07
cd05282323 cd05282, ETR_like, 2-enoyl thioester reductase-lik 3e-07
cd08248350 cd08248, RTN4I1, Human Reticulon 4 Interacting Pro 4e-07
cd08243320 cd08243, quinone_oxidoreductase_like_1, Quinone ox 2e-06
PRK10754327 PRK10754, PRK10754, quinone oxidoreductase, NADPH- 3e-06
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related 4e-06
PRK13771334 PRK13771, PRK13771, putative alcohol dehydrogenase 7e-06
cd08288324 cd08288, MDR_yhdh, Yhdh putative quinone oxidoredu 8e-06
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 5e-05
COG1062366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases 4e-04
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 4e-04
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 5e-04
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 6e-04
cd08291324 cd08291, ETR_like_1, 2-enoyl thioester reductase ( 0.001
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 0.001
>gnl|CDD|176255 cd08295, double_bond_reductase_like, Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
 Score =  404 bits (1041), Expect = e-144
 Identities = 155/209 (74%), Positives = 173/209 (82%), Gaps = 1/209 (0%)

Query: 2   QPISGYGVAKVLDSENPEFNKGDLVWGMTGWEEYSLITAPH-LFKIQHTDVPLSYYTGIL 60
           + I+GYGVAKV+DS NP+F  GDLVWG TGWEEYSLI     L KI HTDVPLSYY G+L
Sbjct: 73  EVITGYGVAKVVDSGNPDFKVGDLVWGFTGWEEYSLIPRGQDLRKIDHTDVPLSYYLGLL 132

Query: 61  GMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLL 120
           GMPG+TAY GFYEVC PK GE VF+SAASGAVGQLVGQ AKL GCYVVGSAGS +KVDLL
Sbjct: 133 GMPGLTAYAGFYEVCKPKKGETVFVSAASGAVGQLVGQLAKLKGCYVVGSAGSDEKVDLL 192

Query: 121 KNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGM 180
           KNK GFD+AFNYKEE DL+AALKRYFP GIDIYF+NVGGK+LDAVL NM + GRIAACGM
Sbjct: 193 KNKLGFDDAFNYKEEPDLDAALKRYFPNGIDIYFDNVGGKMLDAVLLNMNLHGRIAACGM 252

Query: 181 ISQYNLDKPEGVHNLMYLLGNEFAWKDFL 209
           ISQYNL+ PEGV NL+ ++      + FL
Sbjct: 253 ISQYNLEWPEGVRNLLNIIYKRVKIQGFL 281


This group includes proteins identified as the Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase. The Arabidopsis enzyme, a member of the medium chain dehydrogenase/reductase family, catalyzes the reduction of 7-8-double bond of phenylpropanal substrates as a plant defense mechanism. Prostaglandins and related eicosanoids (lipid mediators involved in host defense and inflamation) are metabolized by the oxidation of the 15(S)-hydroxyl group of the NAD+-dependent (type I 15-PGDH) 15-prostaglandin dehydrogenase (15-PGDH) followed by reduction by NADPH/NADH-dependent (type II 15-PGDH) delta-13 15-prostaglandin reductase (13-PGR) to 15-keto-13,14,-dihydroprostaglandins. 13-PGR is a bifunctional enzyme, since it also has leukotriene B(4) 12-hydroxydehydrogenase activity. Leukotriene B4 (LTB4) can be metabolized by LTB4 20-hydroxylase in inflamatory cells, and in other cells by bifunctional LTB4 12-HD/PGR. These 15-PGDH and related enzymes are members of the medium chain dehydrogenase/reductase family. The medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family, which contains the zinc-dependent alcohol dehydrogenase (ADH-Zn) and related proteins, is a diverse group of proteins related to the first identified member, class I mammalian ADH. MDRs display a broad range of activities and are distinguished from the smaller short chain dehydrogenases (~ 250 amino acids vs. the ~ 350 amino acids of the MDR). The MDR proteins have 2 domains: a C-terminal NAD(P) binding-Rossmann fold domain of an beta-alpha form and an N-terminal catalytic domain with distant homology to GroES. Length = 338

>gnl|CDD|215606 PLN03154, PLN03154, putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases Back     alignment and domain information
>gnl|CDD|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176254 cd08294, leukotriene_B4_DH_like, 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>gnl|CDD|131872 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>gnl|CDD|176253 cd08293, PTGR2, Prostaglandin reductase Back     alignment and domain information
>gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members Back     alignment and domain information
>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|234026 TIGR02823, oxido_YhdH, putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information
>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like Back     alignment and domain information
>gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176248 cd08288, MDR_yhdh, Yhdh putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 100.0
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 100.0
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 100.0
COG2130340 Putative NADP-dependent oxidoreductases [General f 100.0
KOG1197336 consensus Predicted quinone oxidoreductase [Energy 100.0
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 100.0
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 100.0
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 100.0
KOG0025354 consensus Zn2+-binding dehydrogenase (nuclear rece 100.0
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 99.98
KOG1196343 consensus Predicted NAD-dependent oxidoreductase [ 99.98
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 99.97
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 99.97
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 99.97
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 99.97
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.97
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 99.97
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 99.97
PLN02740381 Alcohol dehydrogenase-like 99.97
PRK09880343 L-idonate 5-dehydrogenase; Provisional 99.97
PLN02827378 Alcohol dehydrogenase-like 99.97
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 99.97
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 99.97
PLN02586360 probable cinnamyl alcohol dehydrogenase 99.96
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 99.96
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 99.96
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 99.96
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 99.96
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 99.96
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 99.96
PLN02178375 cinnamyl-alcohol dehydrogenase 99.96
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 99.96
KOG0022375 consensus Alcohol dehydrogenase, class III [Second 99.96
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 99.96
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 99.96
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 99.96
PLN02514357 cinnamyl-alcohol dehydrogenase 99.96
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 99.96
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 99.95
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 99.95
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.95
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 99.95
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 99.95
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 99.95
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 99.95
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 99.95
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 99.95
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 99.95
PTZ00354334 alcohol dehydrogenase; Provisional 99.95
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 99.95
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 99.95
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 99.95
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 99.95
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 99.95
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 99.95
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 99.94
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 99.94
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 99.94
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 99.94
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 99.94
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.94
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 99.94
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 99.94
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 99.94
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 99.94
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 99.94
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 99.94
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 99.94
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 99.94
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 99.94
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 99.94
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 99.94
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 99.94
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 99.94
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 99.94
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 99.94
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 99.94
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 99.94
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 99.93
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 99.93
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 99.93
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 99.93
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 99.93
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 99.93
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 99.93
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 99.93
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 99.93
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 99.93
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 99.93
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 99.93
cd08251303 polyketide_synthase polyketide synthase. Polyketid 99.93
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 99.93
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 99.93
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 99.93
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 99.93
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 99.93
PRK10083339 putative oxidoreductase; Provisional 99.93
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 99.93
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 99.93
PRK13771334 putative alcohol dehydrogenase; Provisional 99.92
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 99.92
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 99.92
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 99.92
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 99.92
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 99.92
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 99.92
cd08252336 AL_MDR Arginate lyase and other MDR family members 99.92
PLN02702364 L-idonate 5-dehydrogenase 99.92
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 99.92
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 99.91
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 99.91
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 99.91
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.91
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 99.91
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 99.91
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 99.91
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 99.9
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 99.9
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 99.9
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 99.89
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 99.89
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 99.89
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 99.89
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 99.88
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 99.88
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 99.88
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 99.85
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 99.4
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 99.27
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.02
COG0300265 DltE Short-chain dehydrogenases of various substra 98.76
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 98.67
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 98.59
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 98.54
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 98.48
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 98.48
PRK08324681 short chain dehydrogenase; Validated 98.48
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.47
PRK05693274 short chain dehydrogenase; Provisional 98.47
PRK05993277 short chain dehydrogenase; Provisional 98.45
PRK06182273 short chain dehydrogenase; Validated 98.45
PRK08265261 short chain dehydrogenase; Provisional 98.44
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 98.44
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.44
PRK05872 296 short chain dehydrogenase; Provisional 98.43
PRK12742237 oxidoreductase; Provisional 98.42
PLN02494477 adenosylhomocysteinase 98.41
PRK08339263 short chain dehydrogenase; Provisional 98.4
PRK07825 273 short chain dehydrogenase; Provisional 98.33
PRK06484520 short chain dehydrogenase; Validated 98.29
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.29
PRK07576264 short chain dehydrogenase; Provisional 98.29
PRK06139 330 short chain dehydrogenase; Provisional 98.28
PRK07109 334 short chain dehydrogenase; Provisional 98.28
PRK07062265 short chain dehydrogenase; Provisional 98.28
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 98.26
KOG1610 322 consensus Corticosteroid 11-beta-dehydrogenase and 98.25
PRK06500249 short chain dehydrogenase; Provisional 98.24
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 98.22
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.19
PRK09186256 flagellin modification protein A; Provisional 98.18
PRK06484 520 short chain dehydrogenase; Validated 98.18
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.17
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.16
PRK12829264 short chain dehydrogenase; Provisional 98.16
PRK07806248 short chain dehydrogenase; Provisional 98.16
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 98.15
PRK07814263 short chain dehydrogenase; Provisional 98.15
PRK05876 275 short chain dehydrogenase; Provisional 98.14
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 98.14
PRK09242257 tropinone reductase; Provisional 98.14
PRK12939250 short chain dehydrogenase; Provisional 98.13
PRK05884223 short chain dehydrogenase; Provisional 98.13
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 98.13
PRK06180 277 short chain dehydrogenase; Provisional 98.13
PTZ00075476 Adenosylhomocysteinase; Provisional 98.13
PRK06057255 short chain dehydrogenase; Provisional 98.12
PF11017314 DUF2855: Protein of unknown function (DUF2855); In 98.12
PRK07326237 short chain dehydrogenase; Provisional 98.12
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 98.12
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 98.1
PRK08267260 short chain dehydrogenase; Provisional 98.1
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 98.1
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 98.09
PRK10538248 malonic semialdehyde reductase; Provisional 98.08
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 98.08
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 98.08
PRK12828239 short chain dehydrogenase; Provisional 98.08
PLN03209 576 translocon at the inner envelope of chloroplast su 98.06
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 98.06
PRK08085254 gluconate 5-dehydrogenase; Provisional 98.04
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 98.04
PRK06128300 oxidoreductase; Provisional 98.04
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.03
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.02
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 98.02
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.02
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 98.02
PRK06196 315 oxidoreductase; Provisional 98.02
PRK08263275 short chain dehydrogenase; Provisional 98.01
PRK07832 272 short chain dehydrogenase; Provisional 98.01
PRK07063260 short chain dehydrogenase; Provisional 98.01
PRK05854 313 short chain dehydrogenase; Provisional 98.01
PLN02780 320 ketoreductase/ oxidoreductase 98.0
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.0
PRK06101240 short chain dehydrogenase; Provisional 98.0
PRK05867253 short chain dehydrogenase; Provisional 98.0
PRK05866293 short chain dehydrogenase; Provisional 98.0
PRK05875 276 short chain dehydrogenase; Provisional 97.98
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 97.98
PRK06914 280 short chain dehydrogenase; Provisional 97.98
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 97.98
PRK06179 270 short chain dehydrogenase; Provisional 97.97
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 97.97
PRK07060245 short chain dehydrogenase; Provisional 97.96
PRK07985294 oxidoreductase; Provisional 97.96
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 97.96
KOG1210 331 consensus Predicted 3-ketosphinganine reductase [S 97.96
PRK07478254 short chain dehydrogenase; Provisional 97.96
PRK09072263 short chain dehydrogenase; Provisional 97.96
PRK06949258 short chain dehydrogenase; Provisional 97.95
PRK09291 257 short chain dehydrogenase; Provisional 97.95
PRK07890258 short chain dehydrogenase; Provisional 97.95
PRK07831262 short chain dehydrogenase; Provisional 97.93
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 97.93
PRK06124256 gluconate 5-dehydrogenase; Provisional 97.92
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 97.92
PRK08340259 glucose-1-dehydrogenase; Provisional 97.91
PRK07523255 gluconate 5-dehydrogenase; Provisional 97.91
PRK12747252 short chain dehydrogenase; Provisional 97.91
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 97.91
PRK06198260 short chain dehydrogenase; Provisional 97.9
KOG1208314 consensus Dehydrogenases with different specificit 97.9
PRK06398258 aldose dehydrogenase; Validated 97.9
PRK08177225 short chain dehydrogenase; Provisional 97.9
PRK07453 322 protochlorophyllide oxidoreductase; Validated 97.9
PRK05717255 oxidoreductase; Validated 97.89
PRK08862227 short chain dehydrogenase; Provisional 97.89
PRK07024257 short chain dehydrogenase; Provisional 97.88
PRK06701290 short chain dehydrogenase; Provisional 97.88
PRK08589272 short chain dehydrogenase; Validated 97.88
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 97.88
PRK07677252 short chain dehydrogenase; Provisional 97.87
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 97.87
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.87
PRK08017256 oxidoreductase; Provisional 97.87
PRK06194 287 hypothetical protein; Provisional 97.87
PRK06181 263 short chain dehydrogenase; Provisional 97.87
PRK06841255 short chain dehydrogenase; Provisional 97.86
PLN02253 280 xanthoxin dehydrogenase 97.86
PRK06483236 dihydromonapterin reductase; Provisional 97.85
PRK06940275 short chain dehydrogenase; Provisional 97.85
PRK06197 306 short chain dehydrogenase; Provisional 97.84
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.84
PRK07067257 sorbitol dehydrogenase; Provisional 97.83
PRK07904253 short chain dehydrogenase; Provisional 97.81
PRK06720169 hypothetical protein; Provisional 97.81
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 97.81
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.8
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.8
KOG0725270 consensus Reductases with broad range of substrate 97.79
PLN00015 308 protochlorophyllide reductase 97.79
PRK07774250 short chain dehydrogenase; Provisional 97.79
PRK07035252 short chain dehydrogenase; Provisional 97.78
PRK06953222 short chain dehydrogenase; Provisional 97.78
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.78
PRK08643256 acetoin reductase; Validated 97.77
PRK06172253 short chain dehydrogenase; Provisional 97.77
PRK06482 276 short chain dehydrogenase; Provisional 97.77
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 97.76
PRK05855 582 short chain dehydrogenase; Validated 97.76
PRK12937245 short chain dehydrogenase; Provisional 97.75
PRK08251248 short chain dehydrogenase; Provisional 97.75
PRK08703239 short chain dehydrogenase; Provisional 97.75
PRK07069251 short chain dehydrogenase; Validated 97.74
PRK06138252 short chain dehydrogenase; Provisional 97.74
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.73
PRK06125259 short chain dehydrogenase; Provisional 97.73
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 97.73
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 97.73
PRK08213259 gluconate 5-dehydrogenase; Provisional 97.73
PRK07074257 short chain dehydrogenase; Provisional 97.73
PRK12743256 oxidoreductase; Provisional 97.73
PRK07454241 short chain dehydrogenase; Provisional 97.72
PRK12746254 short chain dehydrogenase; Provisional 97.72
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 97.69
PRK07791 286 short chain dehydrogenase; Provisional 97.69
PRK12367245 short chain dehydrogenase; Provisional 97.68
PRK08277 278 D-mannonate oxidoreductase; Provisional 97.68
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.68
KOG1014 312 consensus 17 beta-hydroxysteroid dehydrogenase typ 97.67
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 97.67
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 97.66
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 97.65
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 97.65
PRK08628258 short chain dehydrogenase; Provisional 97.65
PRK06114254 short chain dehydrogenase; Provisional 97.64
PRK07097265 gluconate 5-dehydrogenase; Provisional 97.64
PRK12938246 acetyacetyl-CoA reductase; Provisional 97.64
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 97.64
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 97.64
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.64
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 97.64
PRK08303 305 short chain dehydrogenase; Provisional 97.63
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 97.63
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 97.62
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 97.61
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 97.6
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 97.6
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 97.59
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 97.58
PRK07856252 short chain dehydrogenase; Provisional 97.57
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 97.56
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.56
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 97.55
PRK08226263 short chain dehydrogenase; Provisional 97.55
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 97.55
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 97.54
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 97.53
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 97.52
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 97.52
PRK05599246 hypothetical protein; Provisional 97.52
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.51
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 97.51
CHL00194 317 ycf39 Ycf39; Provisional 97.5
PRK08219227 short chain dehydrogenase; Provisional 97.5
PRK05650 270 short chain dehydrogenase; Provisional 97.49
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 97.49
PRK07577234 short chain dehydrogenase; Provisional 97.49
PRK07424406 bifunctional sterol desaturase/short chain dehydro 97.48
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 97.48
PRK06523260 short chain dehydrogenase; Provisional 97.46
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 97.46
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 97.45
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 97.44
PRK08278273 short chain dehydrogenase; Provisional 97.44
PRK12744257 short chain dehydrogenase; Provisional 97.44
COG4122219 Predicted O-methyltransferase [General function pr 97.44
PRK07775 274 short chain dehydrogenase; Provisional 97.44
PRK09135249 pteridine reductase; Provisional 97.43
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.43
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 97.42
PRK08264238 short chain dehydrogenase; Validated 97.42
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 97.41
PRK07201 657 short chain dehydrogenase; Provisional 97.41
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.4
PRK08936261 glucose-1-dehydrogenase; Provisional 97.4
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 97.39
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 97.39
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 97.37
PRK09134258 short chain dehydrogenase; Provisional 97.35
PRK07102243 short chain dehydrogenase; Provisional 97.35
PRK07578199 short chain dehydrogenase; Provisional 97.35
TIGR02415254 23BDH acetoin reductases. One member of this famil 97.34
PRK07023243 short chain dehydrogenase; Provisional 97.33
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 97.24
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 97.22
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 97.21
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 97.21
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.2
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 97.2
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 97.2
PRK12935247 acetoacetyl-CoA reductase; Provisional 97.2
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 97.19
PLN02476278 O-methyltransferase 97.19
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 97.16
PRK13940414 glutamyl-tRNA reductase; Provisional 97.15
COG2910211 Putative NADH-flavin reductase [General function p 97.15
PRK06947248 glucose-1-dehydrogenase; Provisional 97.12
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 97.11
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 97.11
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 97.11
PRK14027283 quinate/shikimate dehydrogenase; Provisional 97.11
PRK06123248 short chain dehydrogenase; Provisional 97.1
TIGR00438188 rrmJ cell division protein FtsJ. 97.1
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 97.09
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 97.08
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 97.07
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 97.06
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 97.06
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.05
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 97.04
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 97.04
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 97.04
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 97.03
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 97.03
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 97.03
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 97.02
PRK12549284 shikimate 5-dehydrogenase; Reviewed 97.01
PRK12824245 acetoacetyl-CoA reductase; Provisional 97.01
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 96.99
PRK12827249 short chain dehydrogenase; Provisional 96.98
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 96.97
PRK07041230 short chain dehydrogenase; Provisional 96.96
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 96.96
COG1028251 FabG Dehydrogenases with different specificities ( 96.95
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 96.94
PRK12550272 shikimate 5-dehydrogenase; Reviewed 96.94
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 96.93
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 96.92
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 96.92
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.91
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.91
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.89
PLN02589247 caffeoyl-CoA O-methyltransferase 96.88
PRK07402196 precorrin-6B methylase; Provisional 96.86
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 96.85
PRK04148134 hypothetical protein; Provisional 96.85
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.84
PRK11207197 tellurite resistance protein TehB; Provisional 96.83
PRK06924251 short chain dehydrogenase; Provisional 96.83
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 96.82
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 96.81
PLN00016 378 RNA-binding protein; Provisional 96.81
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 96.79
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 96.78
PLN02686 367 cinnamoyl-CoA reductase 96.77
PRK00811283 spermidine synthase; Provisional 96.77
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.73
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 96.73
PLN02244340 tocopherol O-methyltransferase 96.72
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.71
PRK08309177 short chain dehydrogenase; Provisional 96.71
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 96.71
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.71
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 96.7
PRK08618325 ornithine cyclodeaminase; Validated 96.67
PRK06718202 precorrin-2 dehydrogenase; Reviewed 96.65
PLN02896 353 cinnamyl-alcohol dehydrogenase 96.64
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 96.62
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 96.62
PRK08655 437 prephenate dehydrogenase; Provisional 96.62
PLN02366308 spermidine synthase 96.61
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.6
PLN02653 340 GDP-mannose 4,6-dehydratase 96.58
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 96.58
PRK14982340 acyl-ACP reductase; Provisional 96.58
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 96.55
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 96.55
PRK07574385 formate dehydrogenase; Provisional 96.54
PRK06719157 precorrin-2 dehydrogenase; Validated 96.53
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 96.5
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 96.48
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 96.47
PLN03139386 formate dehydrogenase; Provisional 96.47
COG0623259 FabI Enoyl-[acyl-carrier-protein] 96.45
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 96.44
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 96.44
PLN02650 351 dihydroflavonol-4-reductase 96.43
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 96.43
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 96.4
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 96.4
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 96.38
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 96.38
KOG1611249 consensus Predicted short chain-type dehydrogenase 96.38
PLN02233261 ubiquinone biosynthesis methyltransferase 96.36
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 96.36
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 96.33
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.33
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 96.32
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 96.32
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 96.31
PLN00198 338 anthocyanidin reductase; Provisional 96.3
PLN02214 342 cinnamoyl-CoA reductase 96.3
KOG4022236 consensus Dihydropteridine reductase DHPR/QDPR [Am 96.3
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 96.29
PRK08317241 hypothetical protein; Provisional 96.27
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.26
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 96.26
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 96.23
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.22
PRK13255218 thiopurine S-methyltransferase; Reviewed 96.21
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 96.21
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 96.2
PRK04457262 spermidine synthase; Provisional 96.19
PLN02427 386 UDP-apiose/xylose synthase 96.18
PRK14967223 putative methyltransferase; Provisional 96.17
PLN02240 352 UDP-glucose 4-epimerase 96.15
PLN00203 519 glutamyl-tRNA reductase 96.15
PRK01581374 speE spermidine synthase; Validated 96.15
PRK13243333 glyoxylate reductase; Reviewed 96.15
smart00822180 PKS_KR This enzymatic domain is part of bacterial 96.13
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 96.13
PLN03075296 nicotianamine synthase; Provisional 96.13
PLN02695 370 GDP-D-mannose-3',5'-epimerase 96.12
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.11
PRK06849 389 hypothetical protein; Provisional 96.08
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 96.08
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.06
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 96.06
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 96.02
PRK10258251 biotin biosynthesis protein BioC; Provisional 96.01
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 96.01
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 96.01
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 95.99
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 95.97
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.97
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.96
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 95.95
PLN02928347 oxidoreductase family protein 95.94
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=3.7e-37  Score=256.49  Aligned_cols=217  Identities=28%  Similarity=0.458  Sum_probs=188.5

Q ss_pred             eeeeeEEEEecCCCCCCCCCCEEEEc------cCceeEEEecCCceeeecCCCCCccchhcccCchHHHHHHHHHHhcCC
Q 026828            4 ISGYGVAKVLDSENPEFNKGDLVWGM------TGWEEYSLITAPHLFKIQHTDVPLSYYTGILGMPGMTAYVGFYEVCSP   77 (232)
Q Consensus         4 i~g~G~v~~vG~~v~~~~~Gd~V~~~------g~~~~~~~v~~~~~~~i~p~~~~~~~~~a~l~~~~~ta~~~l~~~~~~   77 (232)
                      .|++|+|+++|++|+.|++||||+.+      |+|+||+.+|+..++++ |+++++. ++|+++++++|||+++....++
T Consensus        63 ~d~aG~V~avG~~V~~~~~GdrV~~~~~~~~~G~~AEy~~v~a~~~~~~-P~~ls~~-eAAal~~~~~TA~~~l~~~~~l  140 (326)
T COG0604          63 SEAAGVVVAVGSGVTGFKVGDRVAALGGVGRDGGYAEYVVVPADWLVPL-PDGLSFE-EAAALPLAGLTAWLALFDRAGL  140 (326)
T ss_pred             ceeEEEEEEeCCCCCCcCCCCEEEEccCCCCCCcceeEEEecHHHceeC-CCCCCHH-HHHHHHHHHHHHHHHHHHhcCC
Confidence            45689999999999999999999886      68999999999999999 9997766 5999999999999999999999


Q ss_pred             CCCCEEEEEcCCchHHHHHHHHHHHcCCeEEEEeCCHHHHHHHHHHhCCCeEEecCChHHHHHHHHHhCCC-CccEEEEC
Q 026828           78 KHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEADLNAALKRYFPE-GIDIYFEN  156 (232)
Q Consensus        78 ~~g~~vlI~ga~g~vG~~~~~~~~~~g~~V~~~~~~~~~~~~~~~~lg~~~v~~~~~~~~~~~~~~~~~~~-~~d~v~d~  156 (232)
                      ++|++|||+||+|++|.+++|+++..|+.++++..++++.++++ ++|+++++++.+. ++.+.+++.+++ ++|+++|+
T Consensus       141 ~~g~~VLV~gaaGgVG~~aiQlAk~~G~~~v~~~~s~~k~~~~~-~lGAd~vi~y~~~-~~~~~v~~~t~g~gvDvv~D~  218 (326)
T COG0604         141 KPGETVLVHGAAGGVGSAAIQLAKALGATVVAVVSSSEKLELLK-ELGADHVINYREE-DFVEQVRELTGGKGVDVVLDT  218 (326)
T ss_pred             CCCCEEEEecCCchHHHHHHHHHHHcCCcEEEEecCHHHHHHHH-hcCCCEEEcCCcc-cHHHHHHHHcCCCCceEEEEC
Confidence            99999999999999999999999999988888888888888888 9999999999887 899999999988 89999999


Q ss_pred             CChhHHHHHHhccccCCEEEEEcccccccCCCCcCccchHHhhhcceeeEEeecccc-hhhhhhHHHHHHhhh
Q 026828          157 VGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGVHNLMYLLGNEFAWKDFLPVIS-TTNIRNSWNWLCRQS  228 (232)
Q Consensus       157 ~g~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~-~~~~~~~~~~~~~~~  228 (232)
                      +|+..+..++++|+++|+++.+|..++    .....++...++.+.+.++|+..... ++...+.++.+.+.+
T Consensus       219 vG~~~~~~~l~~l~~~G~lv~ig~~~g----~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~l~~~~  287 (326)
T COG0604         219 VGGDTFAASLAALAPGGRLVSIGALSG----GPPVPLNLLPLLGKRLTLRGVTLGSRDPEALAEALAELFDLL  287 (326)
T ss_pred             CCHHHHHHHHHHhccCCEEEEEecCCC----CCccccCHHHHhhccEEEEEecceecchHHHHHHHHHHHHHH
Confidence            999999999999999999999999874    22333567778889999999998743 123333444343333



>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0025 consensus Zn2+-binding dehydrogenase (nuclear receptor binding factor-1) [Transcription; Energy production and conversion] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>KOG1196 consensus Predicted NAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>KOG0022 consensus Alcohol dehydrogenase, class III [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF11017 DUF2855: Protein of unknown function (DUF2855); InterPro: IPR021276 This family of proteins has no known function Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
4hfj_A351 X-ray Crystal Structure Of A Double Bond Reductase 8e-94
2j3h_A345 Crystal Structure Of Arabidopsis Thaliana Double Bo 2e-87
4b7c_A336 Crystal Structure Of Hypothetical Protein Pa1648 Fr 3e-42
1v3t_A333 Crystal Structure Of Leukotriene B4 12- Hydroxydehy 7e-42
1zsv_A349 Crystal Structure Of Human Nadp-Dependent Leukotrie 3e-40
2y05_A328 Crystal Structure Of Human Leukotriene B4 12-Hydrox 4e-40
2zb4_A357 Crystal Structure Of Human 15-Ketoprostaglandin Del 6e-29
2w4q_A357 Crystal Structure Of Human Zinc-Binding Alcohol Deh 7e-29
2zb3_A353 Crystal Structure Of Mouse 15-Ketoprostaglandin Del 7e-28
1vj1_A363 Crystal Structure Of Putative Nadph-Dependent Oxido 5e-26
2x7h_A370 Crystal Structure Of The Human Mgc45594 Gene Produc 5e-18
2c0c_A362 Structure Of The Mgc45594 Gene Product Length = 362 5e-18
2wek_A341 Crystal Structure Of The Human Mgc45594 Gene Produc 5e-18
1yb5_A351 Crystal Structure Of Human Zeta-crystallin With Bou 2e-10
1wly_A333 Crystal Structure Of 2-haloacrylate Reductase Lengt 6e-09
1o89_A345 Crystal Structure Of E. Coli K-12 Yhdh Length = 345 2e-06
3qwa_A334 Crystal Structure Of Saccharomyces Cerevisiae Zeta- 2e-06
3jyl_A325 Crystal Structures Of Pseudomonas Syringae Pv. Toma 7e-06
2eih_A343 Crystal Structure Of Nad-Dependent Alcohol Dehydrog 9e-06
2j8z_A354 Crystal Structure Of Human P53 Inducible Oxidoreduc 1e-05
2oby_A338 Crystal Structure Of Human P53 Inducible Oxidoreduc 2e-05
4dup_A353 Crystal Structure Of A Quinone Oxidoreductase From 2e-05
4a27_A349 Crystal Structure Of Human Synaptic Vesicle Membran 2e-05
3fbg_A346 Crystal Structure Of A Putative Arginate Lyase From 6e-05
3slk_A 795 Structure Of Ketoreductase And Enoylreductase Didom 4e-04
1qor_A327 Crystal Structure Of Escherichia Coli Quinone Oxido 6e-04
2vz8_A 2512 Crystal Structure Of Mammalian Fatty Acid Synthase 6e-04
3uog_A363 Crystal Structure Of Putative Alcohol Dehydrogenase 7e-04
3nx4_A324 Crystal Structure Of The Yhdh Oxidoreductase From S 8e-04
>pdb|4HFJ|A Chain A, X-ray Crystal Structure Of A Double Bond Reductase From Nicotiana Tabacum Length = 351 Back     alignment and structure

Iteration: 1

Score = 339 bits (869), Expect = 8e-94, Method: Compositional matrix adjust. Identities = 164/208 (78%), Positives = 182/208 (87%), Gaps = 1/208 (0%) Query: 3 PISGYGVAKVLDSENPEFNKGDLVWGMTGWEEYSLITAPH-LFKIQHTDVPLSYYTGILG 61 PI+GYGVAKVL+S +P+F KGDLVWGMTGWEEYS+IT LFKI DVPLSYYTGILG Sbjct: 76 PITGYGVAKVLESGDPKFQKGDLVWGMTGWEEYSIITPTQTLFKIHDKDVPLSYYTGILG 135 Query: 62 MPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLLK 121 MPGMTAY GF+EVCSPK GE VF+SAASGAVGQLVGQFAK+LGCYVVGSAGSK+KVDLLK Sbjct: 136 MPGMTAYAGFHEVCSPKKGETVFVSAASGAVGQLVGQFAKMLGCYVVGSAGSKEKVDLLK 195 Query: 122 NKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACGMI 181 +KFGFDEAFNYKEE DL+AALKRYFP+GIDIYFENVGGK+LDAVL NMK+ GRIA CGMI Sbjct: 196 SKFGFDEAFNYKEEQDLSAALKRYFPDGIDIYFENVGGKMLDAVLVNMKLYGRIAVCGMI 255 Query: 182 SQYNLDKPEGVHNLMYLLGNEFAWKDFL 209 SQYNL++ EGVHNL L+ + FL Sbjct: 256 SQYNLEQTEGVHNLFCLITKRIRMEGFL 283
>pdb|2J3H|A Chain A, Crystal Structure Of Arabidopsis Thaliana Double Bond Reductase (At5g16970)-Apo Form Length = 345 Back     alignment and structure
>pdb|4B7C|A Chain A, Crystal Structure Of Hypothetical Protein Pa1648 From Pseudomonas Aeruginosa. Length = 336 Back     alignment and structure
>pdb|1V3T|A Chain A, Crystal Structure Of Leukotriene B4 12- Hydroxydehydrogenase15-Oxo-Prostaglandin 13-Reductase Length = 333 Back     alignment and structure
>pdb|1ZSV|A Chain A, Crystal Structure Of Human Nadp-Dependent Leukotriene B4 12- Hydroxydehydrogenase Length = 349 Back     alignment and structure
>pdb|2Y05|A Chain A, Crystal Structure Of Human Leukotriene B4 12-Hydroxydehydrogenase In Complex With Nadp And Raloxifene Length = 328 Back     alignment and structure
>pdb|2ZB4|A Chain A, Crystal Structure Of Human 15-Ketoprostaglandin Delta-13- Reductase In Complex With Nadp And 15-Keto-Pge2 Length = 357 Back     alignment and structure
>pdb|2W4Q|A Chain A, Crystal Structure Of Human Zinc-Binding Alcohol Dehydrogenase 1 (Zadh1) In Ternary Complex With Nadp And 18beta-Glycyrrhetinic Acid Length = 357 Back     alignment and structure
>pdb|2ZB3|A Chain A, Crystal Structure Of Mouse 15-Ketoprostaglandin Delta-13- Reductase In Complex With Nadph Length = 353 Back     alignment and structure
>pdb|1VJ1|A Chain A, Crystal Structure Of Putative Nadph-Dependent Oxidoreductase From Mus Musculus At 2.10 A Resolution Length = 363 Back     alignment and structure
>pdb|2X7H|A Chain A, Crystal Structure Of The Human Mgc45594 Gene Product In Complex With Fenoprofen Length = 370 Back     alignment and structure
>pdb|2C0C|A Chain A, Structure Of The Mgc45594 Gene Product Length = 362 Back     alignment and structure
>pdb|2WEK|A Chain A, Crystal Structure Of The Human Mgc45594 Gene Product In Complex With Diclofenac Length = 341 Back     alignment and structure
>pdb|1YB5|A Chain A, Crystal Structure Of Human Zeta-crystallin With Bound Nadp Length = 351 Back     alignment and structure
>pdb|1WLY|A Chain A, Crystal Structure Of 2-haloacrylate Reductase Length = 333 Back     alignment and structure
>pdb|1O89|A Chain A, Crystal Structure Of E. Coli K-12 Yhdh Length = 345 Back     alignment and structure
>pdb|3QWA|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Zeta-Crystallin-Like Quinone Oxidoreductase Zta1 Length = 334 Back     alignment and structure
>pdb|3JYL|A Chain A, Crystal Structures Of Pseudomonas Syringae Pv. Tomato Dc3000 Quinone Oxidoreductase Length = 325 Back     alignment and structure
>pdb|2EIH|A Chain A, Crystal Structure Of Nad-Dependent Alcohol Dehydrogenase Length = 343 Back     alignment and structure
>pdb|2J8Z|A Chain A, Crystal Structure Of Human P53 Inducible Oxidoreductase ( Tp53i3,Pig3) Length = 354 Back     alignment and structure
>pdb|2OBY|A Chain A, Crystal Structure Of Human P53 Inducible Oxidoreductase (Tp53i3,Pig3) Length = 338 Back     alignment and structure
>pdb|4DUP|A Chain A, Crystal Structure Of A Quinone Oxidoreductase From Rhizobium Etli Cfn 42 Length = 353 Back     alignment and structure
>pdb|4A27|A Chain A, Crystal Structure Of Human Synaptic Vesicle Membrane Protein Vat-1 Homolog-Like Protein Length = 349 Back     alignment and structure
>pdb|3FBG|A Chain A, Crystal Structure Of A Putative Arginate Lyase From Staphylococcus Haemolyticus Length = 346 Back     alignment and structure
>pdb|3SLK|A Chain A, Structure Of Ketoreductase And Enoylreductase Didomain From Modular Polyketide Synthase Length = 795 Back     alignment and structure
>pdb|1QOR|A Chain A, Crystal Structure Of Escherichia Coli Quinone Oxidoreductase Complexed With Nadph Length = 327 Back     alignment and structure
>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase Length = 2512 Back     alignment and structure
>pdb|3UOG|A Chain A, Crystal Structure Of Putative Alcohol Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 363 Back     alignment and structure
>pdb|3NX4|A Chain A, Crystal Structure Of The Yhdh Oxidoreductase From Salmonella Enterica In Complex With Nadp Length = 324 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 1e-127
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 1e-117
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 1e-108
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 3e-68
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 4e-22
3gms_A340 Putative NADPH:quinone reductase; structural genom 5e-22
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 6e-22
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 1e-21
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 1e-21
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 2e-21
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 3e-21
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 2e-20
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 2e-20
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 3e-19
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 6e-19
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 6e-19
4eye_A342 Probable oxidoreductase; structural genomics, niai 8e-19
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 5e-18
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 5e-18
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 6e-18
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 9e-18
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 1e-17
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 1e-17
3krt_A456 Crotonyl COA reductase; structural genomics, prote 2e-17
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 3e-17
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 8e-17
3fbg_A346 Putative arginate lyase; structural genomics, unkn 1e-15
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 1e-15
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 2e-15
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 7e-15
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 1e-14
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 3e-13
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 4e-13
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 4e-10
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 4e-09
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 4e-08
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 6e-08
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 1e-06
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 1e-05
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 3e-05
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 7e-05
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Length = 345 Back     alignment and structure
 Score =  363 bits (933), Expect = e-127
 Identities = 149/202 (73%), Positives = 173/202 (85%), Gaps = 2/202 (0%)

Query: 2   QPISGYGVAKVLDSENPEFNKGDLVWGMTGWEEYSLITAP--HLFKIQHTDVPLSYYTGI 59
           QPI GYGV+++++S +P++ KGDL+WG+  WEEYS+IT      FKIQHTDVPLSYYTG+
Sbjct: 76  QPIQGYGVSRIIESGHPDYKKGDLLWGIVAWEEYSVITPMTHAHFKIQHTDVPLSYYTGL 135

Query: 60  LGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDL 119
           LGMPGMTAY GFYEVCSPK GE V++SAASGAVGQLVGQ AK++GCYVVGSAGSK+KVDL
Sbjct: 136 LGMPGMTAYAGFYEVCSPKEGETVYVSAASGAVGQLVGQLAKMMGCYVVGSAGSKEKVDL 195

Query: 120 LKNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMKIRGRIAACG 179
           LK KFGFD+AFNYKEE+DL AALKR FP GIDIYFENVGGK+LDAVL NM + GRIA CG
Sbjct: 196 LKTKFGFDDAFNYKEESDLTAALKRCFPNGIDIYFENVGGKMLDAVLVNMNMHGRIAVCG 255

Query: 180 MISQYNLDKPEGVHNLMYLLGN 201
           MISQYNL+  EGVHNL  ++  
Sbjct: 256 MISQYNLENQEGVHNLSNIIYK 277


>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Length = 333 Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Length = 357 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Length = 324 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Length = 328 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Length = 330 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Length = 198 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 100.0
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 100.0
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 100.0
4eye_A342 Probable oxidoreductase; structural genomics, niai 100.0
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 100.0
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 100.0
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 100.0
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 100.0
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 100.0
3krt_A456 Crotonyl COA reductase; structural genomics, prote 100.0
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 100.0
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 100.0
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 100.0
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 100.0
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 100.0
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 100.0
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 100.0
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 100.0
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 100.0
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 100.0
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 100.0
3fbg_A346 Putative arginate lyase; structural genomics, unkn 100.0
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 100.0
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 100.0
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 100.0
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 100.0
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 100.0
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 100.0
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 100.0
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 100.0
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 100.0
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 100.0
3gms_A340 Putative NADPH:quinone reductase; structural genom 100.0
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 100.0
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 100.0
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 100.0
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 100.0
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 100.0
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 100.0
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 100.0
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 100.0
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 100.0
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 100.0
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 100.0
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 100.0
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 100.0
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 100.0
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 100.0
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 100.0
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 100.0
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 100.0
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 100.0
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 100.0
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 100.0
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 100.0
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 100.0
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 100.0
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 100.0
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 100.0
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 100.0
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 100.0
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 100.0
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 99.98
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 99.98
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 99.98
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 99.97
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 99.97
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.94
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 99.92
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 99.09
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 99.04
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.03
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 99.0
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.93
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 98.9
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 98.85
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 98.83
4eso_A255 Putative oxidoreductase; NADP, structural genomics 98.75
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 98.74
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 98.73
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 98.72
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 98.7
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.7
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 98.69
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 98.6
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 98.6
4dqx_A277 Probable oxidoreductase protein; structural genomi 98.6
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 98.59
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 98.58
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 98.57
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 98.57
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 98.57
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 98.57
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 98.56
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 98.56
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 98.56
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 98.56
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 98.55
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 98.55
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.54
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.51
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 98.51
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 98.51
3tjr_A301 Short chain dehydrogenase; structural genomics, se 98.51
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 98.51
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 98.5
3imf_A257 Short chain dehydrogenase; structural genomics, in 98.5
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 98.48
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 98.47
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 98.47
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 98.47
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 98.47
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 98.47
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 98.47
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 98.47
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 98.46
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 98.46
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 98.46
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 98.46
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.46
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 98.46
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 98.45
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 98.45
3gem_A260 Short chain dehydrogenase; structural genomics, AP 98.45
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 98.45
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 98.45
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 98.45
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 98.44
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 98.44
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 98.44
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 98.44
1nff_A260 Putative oxidoreductase RV2002; directed evolution 98.44
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 98.43
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 98.43
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 98.43
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 98.43
1spx_A 278 Short-chain reductase family member (5L265); paral 98.43
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 98.42
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 98.42
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 98.42
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 98.42
1xhl_A297 Short-chain dehydrogenase/reductase family member 98.41
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.41
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 98.41
3tox_A280 Short chain dehydrogenase; structural genomics, PS 98.4
3rih_A293 Short chain dehydrogenase or reductase; structural 98.4
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 98.4
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 98.4
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 98.4
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 98.4
3cxt_A291 Dehydrogenase with different specificities; rossma 98.4
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 98.4
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 98.4
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 98.4
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 98.39
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 98.39
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 98.39
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 98.39
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 98.39
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 98.39
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 98.38
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 98.38
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 98.38
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 98.38
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 98.38
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 98.38
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 98.38
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 98.38
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 98.37
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 98.37
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 98.37
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 98.36
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 98.36
3edm_A259 Short chain dehydrogenase; structural genomics, ox 98.36
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 98.36
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 98.35
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.35
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 98.35
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 98.35
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 98.35
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 98.34
3tsc_A277 Putative oxidoreductase; structural genomics, seat 98.34
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 98.34
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.34
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 98.34
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 98.34
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 98.33
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.33
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 98.33
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 98.32
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 98.32
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 98.32
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 98.32
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 98.31
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 98.31
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 98.31
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 98.31
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 98.3
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 98.3
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 98.29
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 98.29
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 98.29
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 98.28
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 98.28
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 98.28
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 98.28
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 98.27
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 98.27
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 98.27
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 98.27
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 98.27
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 98.26
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 98.26
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 98.26
3e03_A274 Short chain dehydrogenase; structural genomics, PS 98.25
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 98.25
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 98.24
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 98.24
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 98.23
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 98.23
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 98.23
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 98.23
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 98.22
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 98.22
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.22
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 98.22
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 98.21
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 98.21
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 98.21
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 98.21
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 98.21
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 98.21
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 98.2
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 98.2
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 98.2
1xq1_A266 Putative tropinone reducatse; structural genomics, 98.19
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 98.18
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 98.18
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 98.18
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 98.17
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 98.17
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 98.17
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 98.16
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 98.16
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 98.16
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 98.15
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.15
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 98.15
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 98.15
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.15
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 98.14
1xkq_A 280 Short-chain reductase family member (5D234); parra 98.13
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 98.13
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 98.13
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 98.12
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 98.12
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 98.11
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 98.1
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 98.09
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 98.09
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 98.09
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 98.09
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 98.08
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 98.08
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 98.08
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 98.08
1ooe_A236 Dihydropteridine reductase; structural genomics, P 98.07
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 98.07
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 98.06
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 98.06
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 98.06
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 98.06
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 98.06
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 98.05
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 98.05
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 98.05
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 98.04
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 98.03
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 98.02
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 98.02
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 98.02
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 98.0
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.0
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 98.0
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.99
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.99
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 97.99
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 97.98
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 97.97
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 97.96
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.95
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 97.94
4e4y_A244 Short chain dehydrogenase family protein; structur 97.93
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 97.93
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 97.93
2rir_A300 Dipicolinate synthase, A chain; structural genomic 97.9
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 97.88
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 97.87
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.86
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 97.85
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 97.84
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 97.81
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 97.8
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 97.78
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.74
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 97.73
2b25_A336 Hypothetical protein; structural genomics, methyl 97.72
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.71
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 97.71
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.7
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.7
1xq6_A 253 Unknown protein; structural genomics, protein stru 97.69
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 97.69
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 97.69
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.69
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 97.68
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 97.68
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 97.67
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 97.66
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 97.66
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 97.66
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 97.65
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 97.61
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 97.61
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 97.61
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 97.6
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 97.59
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.58
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 97.56
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 97.55
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 97.54
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 97.54
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.52
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 97.52
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.51
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.51
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 97.5
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 97.48
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 97.48
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 97.47
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 97.47
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.46
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 97.44
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 97.44
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 97.44
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 97.42
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 97.41
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 97.4
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.39
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 97.39
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 97.38
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 97.38
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.37
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 97.37
3duw_A223 OMT, O-methyltransferase, putative; alternating of 97.36
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 97.35
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 97.35
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 97.35
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 97.34
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 97.34
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.34
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 97.34
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 97.33
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 97.32
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 97.32
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.32
2avd_A229 Catechol-O-methyltransferase; structural genomics, 97.31
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 97.31
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 97.3
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 97.3
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.3
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 97.29
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.28
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 97.28
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 97.26
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.26
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 97.25
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 97.24
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 97.24
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.23
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 97.23
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 97.23
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 97.23
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 97.23
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 97.22
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 97.22
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 97.21
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 97.21
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 97.21
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.18
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 97.18
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.17
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 97.16
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 97.15
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 97.14
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 97.13
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.12
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.11
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.11
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.09
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 97.08
3p2o_A285 Bifunctional protein fold; structural genomics, ce 97.08
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 97.07
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.06
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.05
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 97.04
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 97.04
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.02
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 97.02
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 97.02
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 97.02
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 97.02
3l07_A285 Bifunctional protein fold; structural genomics, ID 97.01
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 97.01
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 96.99
1id1_A153 Putative potassium channel protein; RCK domain, E. 96.99
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 96.98
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 96.97
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 96.97
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 96.97
1yb2_A275 Hypothetical protein TA0852; structural genomics, 96.96
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 96.96
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 96.95
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 96.94
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 96.92
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 96.92
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 96.92
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 96.91
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 96.9
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 96.9
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 96.89
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 96.89
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 96.87
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 96.87
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 96.87
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 96.86
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 96.86
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 96.85
3f4k_A257 Putative methyltransferase; structural genomics, P 96.85
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 96.84
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 96.84
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 96.82
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 96.82
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 96.82
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 96.81
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 96.81
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 96.81
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 96.81
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 96.8
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 96.8
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 96.79
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 96.79
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.78
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 96.78
3gjy_A317 Spermidine synthase; APC62791, structural genomics 96.78
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 96.78
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.77
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 96.77
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 96.77
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 96.77
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 96.76
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 96.76
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 96.76
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 96.75
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 96.75
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 96.75
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 96.74
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 96.74
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 96.73
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 96.73
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 96.72
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 96.71
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 96.71
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 96.7
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 96.69
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 96.69
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 96.69
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 96.68
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 96.68
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 96.68
3m33_A226 Uncharacterized protein; structural genomics, PSI- 96.67
1vl5_A260 Unknown conserved protein BH2331; putative methylt 96.67
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 96.66
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 96.66
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 96.66
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 96.66
4f6c_A 427 AUSA reductase domain protein; thioester reductase 96.66
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 96.65
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 96.64
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 96.64
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 96.63
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.62
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 96.62
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 96.61
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 96.6
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 96.59
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 96.59
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 96.58
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
Probab=100.00  E-value=4e-36  Score=253.79  Aligned_cols=213  Identities=22%  Similarity=0.244  Sum_probs=189.7

Q ss_pred             eeeeeEEEEecCCCCCCCCCCEEEEc---------------------------cCceeEEEecCCceeeecCCCCCccch
Q 026828            4 ISGYGVAKVLDSENPEFNKGDLVWGM---------------------------TGWEEYSLITAPHLFKIQHTDVPLSYY   56 (232)
Q Consensus         4 i~g~G~v~~vG~~v~~~~~Gd~V~~~---------------------------g~~~~~~~v~~~~~~~i~p~~~~~~~~   56 (232)
                      -|++|+|+++|++|++|++||||++.                           |+|+||+++|+..++++ |+++++. +
T Consensus        89 hE~~G~V~~vG~~v~~~~vGDrV~~~~~~~c~~g~~~c~~~~~~~~~~g~~~~G~~aey~~v~~~~~~~i-P~~~~~~-~  166 (363)
T 3uog_A           89 SDMSGVVEAVGKSVTRFRPGDRVISTFAPGWLDGLRPGTGRTPAYETLGGAHPGVLSEYVVLPEGWFVAA-PKSLDAA-E  166 (363)
T ss_dssp             CEEEEEEEEECTTCCSCCTTCEEEECSSTTCCSSSCCSCSSCCCCCCTTTTSCCCCBSEEEEEGGGEEEC-CTTSCHH-H
T ss_pred             cceEEEEEEECCCCCCCCCCCEEEEeccccccccccccccccccccccCcCCCCcceeEEEechHHeEEC-CCCCCHH-H
Confidence            35689999999999999999999875                           88999999999999999 8887666 4


Q ss_pred             hcccCchHHHHHHHHHHhcCCCCCCEEEEEcCCchHHHHHHHHHHHcCCeEEEEeCCHHHHHHHHHHhCCCeEEecCChH
Q 026828           57 TGILGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLLKNKFGFDEAFNYKEEA  136 (232)
Q Consensus        57 ~a~l~~~~~ta~~~l~~~~~~~~g~~vlI~ga~g~vG~~~~~~~~~~g~~V~~~~~~~~~~~~~~~~lg~~~v~~~~~~~  136 (232)
                      +|+++++++|||+++.+.+++++|++|||+| +|++|++++|+++..|++|+++++++++++.++ ++|+++++|.... 
T Consensus       167 aa~l~~~~~ta~~al~~~~~~~~g~~VlV~G-~G~vG~~a~qla~~~Ga~Vi~~~~~~~~~~~~~-~lGa~~vi~~~~~-  243 (363)
T 3uog_A          167 ASTLPCAGLTAWFALVEKGHLRAGDRVVVQG-TGGVALFGLQIAKATGAEVIVTSSSREKLDRAF-ALGADHGINRLEE-  243 (363)
T ss_dssp             HHTTTTHHHHHHHHHTTTTCCCTTCEEEEES-SBHHHHHHHHHHHHTTCEEEEEESCHHHHHHHH-HHTCSEEEETTTS-
T ss_pred             HhhcccHHHHHHHHHHHhcCCCCCCEEEEEC-CCHHHHHHHHHHHHcCCEEEEEecCchhHHHHH-HcCCCEEEcCCcc-
Confidence            8889999999999998889999999999999 699999999999999999999999999999999 9999999995444 


Q ss_pred             HHHHHHHHhCCC-CccEEEECCChhHHHHHHhccccCCEEEEEcccccccCCCCcCccchHHhhhcceeeEEeecccchh
Q 026828          137 DLNAALKRYFPE-GIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGVHNLMYLLGNEFAWKDFLPVISTT  215 (232)
Q Consensus       137 ~~~~~~~~~~~~-~~d~v~d~~g~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~i~g~~~~~~~~  215 (232)
                      ++.+.+++.+++ ++|++|||+|...++.++++|+++|+++.+|...+.     ...+++..++.|++++.|+... ..+
T Consensus       244 ~~~~~v~~~~~g~g~D~vid~~g~~~~~~~~~~l~~~G~iv~~G~~~~~-----~~~~~~~~~~~~~~~i~g~~~~-~~~  317 (363)
T 3uog_A          244 DWVERVYALTGDRGADHILEIAGGAGLGQSLKAVAPDGRISVIGVLEGF-----EVSGPVGPLLLKSPVVQGISVG-HRR  317 (363)
T ss_dssp             CHHHHHHHHHTTCCEEEEEEETTSSCHHHHHHHEEEEEEEEEECCCSSC-----EECCBTTHHHHTCCEEEECCCC-CHH
T ss_pred             cHHHHHHHHhCCCCceEEEECCChHHHHHHHHHhhcCCEEEEEecCCCc-----ccCcCHHHHHhCCcEEEEEecC-CHH
Confidence            888889988887 899999999998899999999999999999986542     2346777889999999999886 567


Q ss_pred             hhhhHHHHHHhh
Q 026828          216 NIRNSWNWLCRQ  227 (232)
Q Consensus       216 ~~~~~~~~~~~~  227 (232)
                      +++++++++.+.
T Consensus       318 ~~~~~~~l~~~g  329 (363)
T 3uog_A          318 ALEDLVGAVDRL  329 (363)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHHcC
Confidence            788888888765



>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 232
d1v3va2182 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehyd 7e-23
d1vj1a2187 c.2.1.1 (A:125-311) Putative zinc-binding alcohol 1e-22
d1tt7a2167 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bac 6e-15
d1v3va1147 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hyd 9e-15
d1gu7a2189 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yea 7e-14
d1vj1a1166 b.35.1.2 (A:-1-124,A:312-351) Putative zinc-bindin 9e-13
d1xa0a2176 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Ba 1e-12
d1o89a2177 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Esc 3e-12
d2fzwa2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 3e-12
d1qora2179 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escher 2e-11
d2jhfa2176 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( 3e-11
d1o8ca277 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Esc 5e-11
d1pqwa_183 c.2.1.1 (A:) Putative enoyl reductase domain of po 6e-11
d1cdoa2175 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga 3e-10
d1f8fa2174 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { 5e-10
d1vj0a2182 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T 4e-08
d1yb5a2174 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human 1e-07
d1p0fa2174 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog 6e-07
d1kola2195 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Ps 2e-05
d1e3ia2174 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( 8e-04
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 182 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase
species: Guinea pig (Cavia porcellus) [TaxId: 10141]
 Score = 89.7 bits (221), Expect = 7e-23
 Identities = 74/149 (49%), Positives = 90/149 (60%), Gaps = 1/149 (0%)

Query: 51  VPLSYYTGILGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGS 110
           +PLS   G +GMPG+TAY G  EVC  K GE V +SAA+GAVG +VGQ AKL GC VVG+
Sbjct: 1   LPLSLALGTIGMPGLTAYFGLLEVCGVKGGETVLVSAAAGAVGSVVGQIAKLKGCKVVGA 60

Query: 111 AGSKDKVDLLKNKFGFDEAFNYKEEADLNAALKRYFPEGIDIYFENVGGKLLDAVLPNMK 170
           AGS +K+  LK        FNYK    L  ALK+  P+G D YF+NVGG+ L+ VL  MK
Sbjct: 61  AGSDEKIAYLKQIGFDAA-FNYKTVNSLEEALKKASPDGYDCYFDNVGGEFLNTVLSQMK 119

Query: 171 IRGRIAACGMISQYNLDKPEGVHNLMYLL 199
             G+IA CG IS YN             +
Sbjct: 120 DFGKIAICGAISVYNRMDQLPPGPSPESI 148


>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 187 Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 167 Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 147 Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 189 Back     information, alignment and structure
>d1vj1a1 b.35.1.2 (A:-1-124,A:312-351) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 166 Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Length = 176 Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 177 Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 77 Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 183 Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 195 Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.97
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.97
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.97
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.96
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.96
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 99.96
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.96
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.96
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.95
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.95
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.95
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.95
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.95
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 99.94
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.94
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.94
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.94
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.94
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.94
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.94
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.94
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.94
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.93
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.93
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.92
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.92
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.92
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.91
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.59
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 99.58
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.58
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.51
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.48
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.43
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.36
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 99.35
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 99.3
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.28
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.28
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.23
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.19
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.17
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.12
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.1
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.1
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 99.09
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.08
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.06
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 98.98
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 98.97
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 98.95
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 98.93
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 98.92
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 98.92
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 98.91
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 98.89
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 98.89
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 98.87
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 98.87
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 98.85
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 98.84
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 98.79
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 98.79
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 98.79
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 98.79
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 98.77
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 98.76
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 98.75
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 98.75
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 98.73
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 98.73
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 98.72
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 98.71
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 98.69
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 98.69
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 98.69
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 98.69
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 98.69
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 98.67
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 98.66
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 98.65
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 98.65
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 98.63
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 98.63
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 98.61
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 98.58
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.57
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 98.57
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 98.56
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 98.56
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 98.55
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 98.55
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 98.55
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 98.53
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 98.51
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 98.5
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 98.49
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 98.48
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 98.46
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 98.46
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.45
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 98.44
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 98.41
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 98.39
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 98.37
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 98.35
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 98.34
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 98.32
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 98.25
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 98.22
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 98.18
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 98.18
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.12
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 98.09
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 98.07
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.05
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.03
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 98.01
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 97.96
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 97.96
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 97.94
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.92
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 97.91
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 97.89
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 97.88
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 97.85
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 97.84
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.84
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 97.83
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 97.81
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.72
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 97.64
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 97.61
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.6
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 97.58
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.58
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 97.57
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.51
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.49
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 97.47
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 97.43
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 97.39
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 97.39
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 97.37
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 97.36
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 97.36
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 97.34
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.32
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.29
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 97.27
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 97.26
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 97.26
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.24
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.22
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 97.19
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.08
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 97.01
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 96.98
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 96.97
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 96.94
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 96.92
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 96.88
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 96.79
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 96.76
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 96.76
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 96.76
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 96.74
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 96.67
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.58
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 96.57
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 96.56
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 96.53
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 96.51
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 96.51
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 96.49
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 96.47
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 96.46
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 96.43
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.42
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 96.41
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 96.35
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 96.28
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 96.27
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 96.27
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 96.26
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 96.26
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.25
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 96.24
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 96.24
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.2
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.18
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 96.17
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 96.16
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 96.13
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 96.1
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 96.05
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 95.96
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 95.91
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 95.89
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 95.88
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 95.86
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 95.81
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 95.8
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.76
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 95.75
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 95.69
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.67
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 95.43
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 95.41
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 95.39
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 95.37
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 95.26
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 95.24
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 95.19
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 95.13
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 95.1
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 95.09
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 95.08
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 95.05
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 95.04
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.96
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 94.94
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 94.9
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 94.89
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 94.88
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 94.72
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.69
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 94.66
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 94.65
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 94.64
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 94.63
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 94.63
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 94.62
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 94.56
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 94.54
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 94.53
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 94.41
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 94.35
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.28
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 94.26
d1id1a_153 Rck domain from putative potassium channel Kch {Es 94.23
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 94.21
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.18
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 94.17
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 94.12
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.03
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 94.02
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 93.82
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 93.69
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 93.61
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 93.6
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 93.58
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 93.48
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 93.39
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.31
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.28
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 93.23
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 93.22
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 93.22
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 93.19
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 93.17
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 93.16
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 93.16
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 93.15
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 93.15
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 93.04
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 92.98
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 92.95
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 92.94
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 92.87
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 92.82
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 92.72
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 92.57
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 92.52
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 92.52
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 92.48
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 92.45
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 92.38
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 92.37
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 92.34
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 92.3
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 92.3
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 92.27
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 92.2
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 92.14
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 92.08
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 92.01
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 91.99
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 91.96
d1jbqa_ 355 Cystathionine beta-synthase {Human (Homo sapiens) 91.95
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 91.92
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 91.91
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 91.89
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 91.87
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 91.61
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 91.61
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 91.58
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 91.56
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 91.38
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 91.17
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 91.11
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 90.98
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 90.97
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 90.9
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 90.8
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 90.78
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 90.51
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 90.42
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 90.4
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 90.39
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 90.39
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 90.23
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 90.23
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 90.02
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 89.83
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 89.8
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 89.68
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 89.53
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 89.53
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 89.46
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 89.44
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.43
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 89.42
d1z7wa1320 O-acetylserine sulfhydrylase (Cysteine synthase) { 89.24
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 89.23
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 89.16
d1tdja1331 Threonine deaminase {Escherichia coli [TaxId: 562] 88.93
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 88.87
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 88.86
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 88.77
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 88.29
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 88.24
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 88.11
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 88.11
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 88.02
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 88.0
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 87.94
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 87.91
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 87.83
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 87.7
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 87.61
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 87.55
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 87.49
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 87.23
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 87.05
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 86.71
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 86.55
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.53
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 86.52
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 86.47
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 86.25
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 86.15
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 86.13
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 86.1
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 86.09
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 85.87
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 85.62
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 85.49
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 85.38
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 85.37
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 85.31
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 85.15
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 85.02
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 85.0
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 84.97
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 84.89
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 84.76
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 84.67
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 84.65
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 84.61
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 84.49
d2csua3163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 84.46
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 84.4
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 84.25
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 84.08
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 83.7
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 83.67
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 83.48
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 83.45
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 83.19
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 82.97
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 82.92
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 82.87
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 82.81
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 82.77
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 82.45
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 82.4
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 82.37
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 82.17
d1p5ja_ 319 L-serine dehydratase {Human (Homo sapiens) [TaxId: 82.04
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 81.96
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 81.9
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 81.82
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 81.44
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 81.3
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 81.17
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 80.89
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 80.85
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 80.84
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 80.59
d2blna2203 Polymyxin resistance protein ArnA, N-terminal doma 80.3
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 80.28
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 80.14
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 80.09
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Quinone oxidoreductase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=3.2e-31  Score=199.88  Aligned_cols=169  Identities=24%  Similarity=0.310  Sum_probs=151.3

Q ss_pred             ccchhcccCchHHHHHHHHHHhcCCCCCCEEEEEcCCchHHHHHHHHHHHcCCeEEEEeCCHHHHHHHHHHhCCCeEEec
Q 026828           53 LSYYTGILGMPGMTAYVGFYEVCSPKHGECVFISAASGAVGQLVGQFAKLLGCYVVGSAGSKDKVDLLKNKFGFDEAFNY  132 (232)
Q Consensus        53 ~~~~~a~l~~~~~ta~~~l~~~~~~~~g~~vlI~ga~g~vG~~~~~~~~~~g~~V~~~~~~~~~~~~~~~~lg~~~v~~~  132 (232)
                      +. ++|+++++++|||++|.+..++++|++|||+|++|++|++++|+++.+|++|+++++++++++.++ ++|+++++|+
T Consensus         3 ~~-~AA~l~~~~~TA~~al~~~~~~~~g~~VlV~Ga~G~vG~~aiq~a~~~G~~vi~~~~~~~~~~~~~-~~Ga~~vi~~   80 (174)
T d1yb5a2           3 FK-QGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVL-QNGAHEVFNH   80 (174)
T ss_dssp             HH-HHTTTHHHHHHHHHHHHTTSCCCTTCEEEEETCSSHHHHHHHHHHHHTTCEEEEEESSHHHHHHHH-HTTCSEEEET
T ss_pred             HH-HHHHhHHHHHHHHHHHHHHhCCCCCCEEEEEeccccccccccccccccCccccccccccccccccc-ccCccccccc
Confidence            44 488999999999999988999999999999999999999999999999999999999999999999 9999999999


Q ss_pred             CChHHHHHHHHHhCCC-CccEEEECCChhHHHHHHhccccCCEEEEEcccccccCCCCcCccchHHhhhcceeeEEeecc
Q 026828          133 KEEADLNAALKRYFPE-GIDIYFENVGGKLLDAVLPNMKIRGRIAACGMISQYNLDKPEGVHNLMYLLGNEFAWKDFLPV  211 (232)
Q Consensus       133 ~~~~~~~~~~~~~~~~-~~d~v~d~~g~~~~~~~~~~l~~~G~~v~~g~~~~~~~~~~~~~~~~~~~~~~~~~i~g~~~~  211 (232)
                      ++. ++.+.+++.+++ ++|+++||+|+..++.++++|+++|+++.+|..+.       .++++.+++.|+++++|+...
T Consensus        81 ~~~-~~~~~i~~~t~~~g~d~v~d~~g~~~~~~~~~~l~~~G~iv~~G~~~~-------~~~~~~~~~~k~~~i~g~~~~  152 (174)
T d1yb5a2          81 REV-NYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGT-------IEINPRDTMAKESSIIGVTLF  152 (174)
T ss_dssp             TST-THHHHHHHHHCTTCEEEEEESCHHHHHHHHHHHEEEEEEEEECCCCSC-------EEECTHHHHTTTCEEEECCGG
T ss_pred             ccc-cHHHHhhhhhccCCceEEeecccHHHHHHHHhccCCCCEEEEEecCCC-------CCCCHHHHHHCCCEEEEEEec
Confidence            887 899999998887 89999999999999999999999999999986432       346778889999999999875


Q ss_pred             c-chhhhhhHHHHHHhhhhcc
Q 026828          212 I-STTNIRNSWNWLCRQSKKE  231 (232)
Q Consensus       212 ~-~~~~~~~~~~~~~~~~~~~  231 (232)
                      . .++++++..+++.+.++.+
T Consensus       153 ~~~~~~~~~~~~~l~~g~~~G  173 (174)
T d1yb5a2         153 SSTKEEFQQYAAALQAGMEIG  173 (174)
T ss_dssp             GCCHHHHHHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHHHHHHcc
Confidence            3 4677888888888877653



>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2blna2 c.65.1.1 (A:1-203) Polymyxin resistance protein ArnA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure