Citrus Sinensis ID: 026866

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MVGGACSLQLQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFNRRNLDAEPNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVKG
ccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccEEEcccccccccccccEEEEEEEEEEccEEcccccEEEcccccHHHHHcccc
cccccccccccHHHHHHHcccccccccccHHHHHccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEcccHHHHHHHHHHHHHHHHHHHHHHHHcccccEHHHHHHHHHHHHHHcccEEccccHHHcccccEEEEccEEEcccccccEcccccEEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHcc
mvggacslqlqprllssfvgnrfihstqplnqlfgynsgknqVSMQLSRTFSGLADLLFnrrnldaepnrrrkrlrpgkvsphrpvpdhiprppyvnsqkpigivsgpevhdekgieCMRVSGRLAAQVLEYAGtlvkpgittdEIDKAVHQMIIdngaypsplgyggfpksvctsvnecichgipdsraledgdtiniDVTVYLngyhgdtsatffcgdvdDEARNLVKG
mvggacslqlqPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFnrrnldaepnrrrkrlrpgkvsphrpvpdhiprppyvnsqkPIGIVSGPEVHDEKGIECMRVSGRLAAQVLEYAgtlvkpgiTTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIpdsraledgdTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVKG
MVGGACSLQLQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFNRRNLDAEPNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVKG
*******LQLQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFN*******************************************IV****VHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDV**********
*********LQPRLLSSFVGNRFIHSTQPL****************LSRTFSGLADLLFN**NLDAEPNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQK*I**********EKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVK*
MVGGACSLQLQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFNRRNLDAEPNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVKG
*******LQLQPRLLSSFVGNRFIHSTQPLNQLFGYN******SMQLSRTFSGLADLLFNRRNLDAEPNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVKG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGGACSLQLQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFNRRNLDAEPNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVKG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query231 2.2.26 [Sep-21-2011]
Q9FV50 350 Methionine aminopeptidase yes no 0.956 0.631 0.764 5e-96
Q9FV52 369 Methionine aminopeptidase no no 0.792 0.495 0.618 8e-59
Q9FV51 344 Methionine aminopeptidase no no 0.701 0.470 0.641 2e-53
Q54VU7 404 Methionine aminopeptidase yes no 0.679 0.388 0.597 2e-50
P0A5J3 285 Methionine aminopeptidase yes no 0.675 0.547 0.591 1e-45
P0A5J2 285 Methionine aminopeptidase yes no 0.675 0.547 0.591 1e-45
Q4VBS4 338 Methionine aminopeptidase yes no 0.740 0.505 0.543 4e-45
Q9CPW9 335 Methionine aminopeptidase yes no 0.658 0.453 0.568 5e-42
Q6UB28 335 Methionine aminopeptidase yes no 0.649 0.447 0.563 2e-41
A6QLA4 386 Methionine aminopeptidase yes no 0.696 0.417 0.508 7e-41
>sp|Q9FV50|AMP1D_ARATH Methionine aminopeptidase 1D, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=MAP1D PE=2 SV=1 Back     alignment and function desciption
 Score =  350 bits (898), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 190/221 (85%)

Query: 10  LQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFNRRNLDAEPN 69
           LQPRL+SSF+GN  I STQPL  LF ++ G+  VSMQLSRTFSGL DLLFNRRN D   +
Sbjct: 7   LQPRLISSFLGNNSIRSTQPLIHLFRFDLGRRHVSMQLSRTFSGLTDLLFNRRNEDEVID 66

Query: 70  RRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMRVSGRLAAQV 129
            +RKRLRPG VSP RPVP HI +PPYV+S +  GI SG EVHD+KGIECMR SG LAA+V
Sbjct: 67  GKRKRLRPGNVSPRRPVPGHITKPPYVDSLQAPGISSGLEVHDKKGIECMRASGILAARV 126

Query: 130 LEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSR 189
            +YAGTLVKPG+TTDEID+AVH MII+NGAYPSPLGYGGFPKSVCTSVNECICHGIPDSR
Sbjct: 127 RDYAGTLVKPGVTTDEIDEAVHNMIIENGAYPSPLGYGGFPKSVCTSVNECICHGIPDSR 186

Query: 190 ALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVK 230
            LEDGD INIDVTVYLNGYHGDTSATFFCG+VD++A+ LV+
Sbjct: 187 PLEDGDIINIDVTVYLNGYHGDTSATFFCGNVDEKAKKLVE 227
Removes the N-terminal methionine from nascent proteins.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 1EC: .EC: 1EC: 8
>sp|Q9FV52|AMP1B_ARATH Methionine aminopeptidase 1B, chloroplastic OS=Arabidopsis thaliana GN=MAP1B PE=2 SV=2 Back     alignment and function description
>sp|Q9FV51|AMP1C_ARATH Methionine aminopeptidase 1C, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=MAP1C PE=2 SV=2 Back     alignment and function description
>sp|Q54VU7|AMP1D_DICDI Methionine aminopeptidase 1D, mitochondrial OS=Dictyostelium discoideum GN=metap1d PE=3 SV=1 Back     alignment and function description
>sp|P0A5J3|AMPM_MYCBO Methionine aminopeptidase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=map PE=3 SV=1 Back     alignment and function description
>sp|P0A5J2|AMPM2_MYCTU Methionine aminopeptidase 2 OS=Mycobacterium tuberculosis GN=map PE=1 SV=1 Back     alignment and function description
>sp|Q4VBS4|AMP1D_DANRE Methionine aminopeptidase 1D, mitochondrial OS=Danio rerio GN=metap1d PE=2 SV=1 Back     alignment and function description
>sp|Q9CPW9|AMP1D_MOUSE Methionine aminopeptidase 1D, mitochondrial OS=Mus musculus GN=Metap1d PE=2 SV=1 Back     alignment and function description
>sp|Q6UB28|AMP1D_HUMAN Methionine aminopeptidase 1D, mitochondrial OS=Homo sapiens GN=METAP1D PE=1 SV=1 Back     alignment and function description
>sp|A6QLA4|AMPM1_BOVIN Methionine aminopeptidase 1 OS=Bos taurus GN=METAP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
225438676 350 PREDICTED: methionine aminopeptidase 1D, 0.982 0.648 0.821 1e-104
224081610 350 predicted protein [Populus trichocarpa] 0.982 0.648 0.8 1e-103
255637733260 unknown [Glycine max] 0.991 0.880 0.786 1e-100
356496878 356 PREDICTED: methionine aminopeptidase 1D, 0.991 0.643 0.786 1e-100
255565134282 methionine aminopeptidase, putative [Ric 0.982 0.804 0.773 1e-99
449460600 352 PREDICTED: methionine aminopeptidase 1D, 0.943 0.619 0.780 3e-96
297798178 350 hypothetical protein ARALYDRAFT_912645 [ 0.956 0.631 0.773 4e-96
18419957 350 methionine aminopeptidase 1D [Arabidopsi 0.956 0.631 0.764 3e-94
357482963 351 Methionine aminopeptidase [Medicago trun 0.913 0.601 0.762 1e-89
326525605 351 predicted protein [Hordeum vulgare subsp 0.948 0.623 0.695 2e-82
>gi|225438676|ref|XP_002282060.1| PREDICTED: methionine aminopeptidase 1D, chloroplastic/mitochondrial [Vitis vinifera] gi|296082435|emb|CBI21440.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/230 (82%), Positives = 202/230 (87%), Gaps = 3/230 (1%)

Query: 1   MVGGACSLQLQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFN 60
           MVG +    LQPRLLSSFVG+RF+ S +PL+QLF  N G   VSMQLSRTFSGL +LLFN
Sbjct: 1   MVGAS---SLQPRLLSSFVGDRFVQSQRPLHQLFRCNPGNKHVSMQLSRTFSGLTNLLFN 57

Query: 61  RRNLDAEPNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMR 120
           RRNL+  PN +RKRLRPGK+SP RPVP HI RP YV S+KP GIVSGPEVHDEKGIECMR
Sbjct: 58  RRNLEGLPNSKRKRLRPGKLSPCRPVPGHILRPSYVTSKKPPGIVSGPEVHDEKGIECMR 117

Query: 121 VSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNEC 180
            SGRLAAQVLEYAGTLVKPGI TDEID+AVHQMIIDNGAYPSPLGYGGFPKSVCTSVNEC
Sbjct: 118 NSGRLAAQVLEYAGTLVKPGIKTDEIDEAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNEC 177

Query: 181 ICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVK 230
           ICHGIPDSR LEDGD INIDVTVYLNGYHGDTSATFFCGDVDD+AR LV+
Sbjct: 178 ICHGIPDSRPLEDGDIINIDVTVYLNGYHGDTSATFFCGDVDDKARKLVE 227

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224081610|ref|XP_002306464.1| predicted protein [Populus trichocarpa] gi|222855913|gb|EEE93460.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255637733|gb|ACU19189.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356496878|ref|XP_003517292.1| PREDICTED: methionine aminopeptidase 1D, chloroplastic/mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|255565134|ref|XP_002523559.1| methionine aminopeptidase, putative [Ricinus communis] gi|223537121|gb|EEF38754.1| methionine aminopeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449460600|ref|XP_004148033.1| PREDICTED: methionine aminopeptidase 1D, chloroplastic/mitochondrial-like [Cucumis sativus] gi|449502729|ref|XP_004161726.1| PREDICTED: methionine aminopeptidase 1D, chloroplastic/mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297798178|ref|XP_002866973.1| hypothetical protein ARALYDRAFT_912645 [Arabidopsis lyrata subsp. lyrata] gi|297312809|gb|EFH43232.1| hypothetical protein ARALYDRAFT_912645 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18419957|ref|NP_568014.1| methionine aminopeptidase 1D [Arabidopsis thaliana] gi|75172582|sp|Q9FV50.1|AMP1D_ARATH RecName: Full=Methionine aminopeptidase 1D, chloroplastic/mitochondrial; Short=MAP 1D; Short=MetAP 1D; AltName: Full=Peptidase M 1D; Flags: Precursor gi|11320960|gb|AAG33977.1|AF250963_1 methionine aminopeptidase-like protein [Arabidopsis thaliana] gi|21553973|gb|AAM63054.1| methionyl aminopeptidase-like protein [Arabidopsis thaliana] gi|26451668|dbj|BAC42930.1| putative ap2 methionine aminopeptidase [Arabidopsis thaliana] gi|28973551|gb|AAO64100.1| putative methionyl aminopeptidase [Arabidopsis thaliana] gi|332661340|gb|AEE86740.1| methionine aminopeptidase 1D [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357482963|ref|XP_003611768.1| Methionine aminopeptidase [Medicago truncatula] gi|355513103|gb|AES94726.1| Methionine aminopeptidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|326525605|dbj|BAJ88849.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326526241|dbj|BAJ97137.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
TAIR|locus:2115125 350 MAP1D "methionine aminopeptida 0.956 0.631 0.764 1.7e-89
TAIR|locus:2205329 369 MAP1C "methionine aminopeptida 0.792 0.495 0.629 2e-56
TAIR|locus:2085979 344 MAP1B "methionine aminopeptida 0.662 0.444 0.666 1.3e-50
DICTYBASE|DDB_G0280127 404 map1d "methionine aminopeptida 0.735 0.420 0.572 1.4e-48
UNIPROTKB|P0A5J2 285 map "Methionine aminopeptidase 0.675 0.547 0.591 3.9e-44
ZFIN|ZDB-GENE-050522-71 338 metap1d "methionyl aminopeptid 0.740 0.505 0.543 3.5e-43
RGD|1307413 334 Metap1d "methionyl aminopeptid 0.649 0.449 0.588 1.1e-41
UNIPROTKB|F1P5C7 320 METAP1D "Methionine aminopepti 0.649 0.468 0.582 1.7e-41
FB|FBgn0032247 317 CG5188 [Drosophila melanogaste 0.748 0.545 0.494 3.6e-41
UNIPROTKB|F1PFF1 451 METAP1D "Methionine aminopepti 0.649 0.332 0.582 5.9e-41
TAIR|locus:2115125 MAP1D "methionine aminopeptidase 1D" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 893 (319.4 bits), Expect = 1.7e-89, P = 1.7e-89
 Identities = 169/221 (76%), Positives = 190/221 (85%)

Query:    10 LQPRLLSSFVGNRFIHSTQPLNQLFGYNSGKNQVSMQLSRTFSGLADLLFNRRNLDAEPN 69
             LQPRL+SSF+GN  I STQPL  LF ++ G+  VSMQLSRTFSGL DLLFNRRN D   +
Sbjct:     7 LQPRLISSFLGNNSIRSTQPLIHLFRFDLGRRHVSMQLSRTFSGLTDLLFNRRNEDEVID 66

Query:    70 RRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMRVSGRLAAQV 129
              +RKRLRPG VSP RPVP HI +PPYV+S +  GI SG EVHD+KGIECMR SG LAA+V
Sbjct:    67 GKRKRLRPGNVSPRRPVPGHITKPPYVDSLQAPGISSGLEVHDKKGIECMRASGILAARV 126

Query:   130 LEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSR 189
              +YAGTLVKPG+TTDEID+AVH MII+NGAYPSPLGYGGFPKSVCTSVNECICHGIPDSR
Sbjct:   127 RDYAGTLVKPGVTTDEIDEAVHNMIIENGAYPSPLGYGGFPKSVCTSVNECICHGIPDSR 186

Query:   190 ALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVK 230
              LEDGD INIDVTVYLNGYHGDTSATFFCG+VD++A+ LV+
Sbjct:   187 PLEDGDIINIDVTVYLNGYHGDTSATFFCGNVDEKAKKLVE 227
GO:0004177 "aminopeptidase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008235 "metalloexopeptidase activity" evidence=IEA;ISS
GO:0009987 "cellular process" evidence=IEA
GO:0009507 "chloroplast" evidence=IDA;TAS
GO:0031365 "N-terminal protein amino acid modification" evidence=TAS
GO:0009737 "response to abscisic acid stimulus" evidence=IDA
GO:0019408 "dolichol biosynthetic process" evidence=RCA
TAIR|locus:2205329 MAP1C "methionine aminopeptidase 1B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085979 MAP1B "methionine aminopeptidase 1C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0280127 map1d "methionine aminopeptidase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|P0A5J2 map "Methionine aminopeptidase 2" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-71 metap1d "methionyl aminopeptidase type 1D (mitochondrial)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1307413 Metap1d "methionyl aminopeptidase type 1D (mitochondrial)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5C7 METAP1D "Methionine aminopeptidase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0032247 CG5188 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1PFF1 METAP1D "Methionine aminopeptidase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FV50AMP1D_ARATH3, ., 4, ., 1, 1, ., 1, 80.76470.95670.6314yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.11.180.914
3rd Layer3.4.110.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
cd01086 238 cd01086, MetAP1, Methionine Aminopeptidase 1 4e-67
PRK05716 252 PRK05716, PRK05716, methionine aminopeptidase; Val 1e-63
PLN03158 396 PLN03158, PLN03158, methionine aminopeptidase; Pro 2e-60
PRK12896 255 PRK12896, PRK12896, methionine aminopeptidase; Rev 2e-58
COG0024 255 COG0024, Map, Methionine aminopeptidase [Translati 1e-52
TIGR00500 247 TIGR00500, met_pdase_I, methionine aminopeptidase, 8e-49
pfam00557208 pfam00557, Peptidase_M24, Metallopeptidase family 2e-33
PRK12318 291 PRK12318, PRK12318, methionine aminopeptidase; Pro 2e-31
PRK12897 248 PRK12897, PRK12897, methionine aminopeptidase; Rev 2e-24
cd01066207 cd01066, APP_MetAP, A family including aminopeptid 3e-24
COG0006 384 COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid 2e-20
cd01092208 cd01092, APP-like, Similar to Prolidase and Aminop 6e-17
PRK08671 291 PRK08671, PRK08671, methionine aminopeptidase; Pro 1e-14
cd01088 291 cd01088, MetAP2, Methionine Aminopeptidase 2 6e-14
TIGR00501 295 TIGR00501, met_pdase_II, methionine aminopeptidase 9e-12
PRK07281 286 PRK07281, PRK07281, methionine aminopeptidase; Rev 4e-06
cd01089 228 cd01089, PA2G4-like, Related to aminopepdidase M, 1e-05
PRK10879 438 PRK10879, PRK10879, proline aminopeptidase P II; P 2e-05
PTZ00053 470 PTZ00053, PTZ00053, methionine aminopeptidase 2; P 3e-05
cd01066207 cd01066, APP_MetAP, A family including aminopeptid 2e-04
TIGR00495 389 TIGR00495, crvDNA_42K, 42K curved DNA binding prot 2e-04
cd01087 243 cd01087, Prolidase, Prolidase 0.001
>gnl|CDD|238519 cd01086, MetAP1, Methionine Aminopeptidase 1 Back     alignment and domain information 
 Score =  206 bits (527), Expect = 4e-67
 Identities = 67/115 (58%), Positives = 90/115 (78%)

Query: 116 IECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCT 175
           IE MR +GR+ A+VL+     +KPG+TT E+D+  H+ I ++GAYP+PLGY GFPKS+CT
Sbjct: 1   IEGMREAGRIVAEVLDELAKAIKPGVTTKELDQIAHEFIEEHGAYPAPLGYYGFPKSICT 60

Query: 176 SVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVK 230
           SVNE +CHGIPD R L+DGD +NIDV V L+GYHGD++ TF  G+V +EA+ LV+
Sbjct: 61  SVNEVVCHGIPDDRVLKDGDIVNIDVGVELDGYHGDSARTFIVGEVSEEAKKLVE 115

E.C. 3.4.11.18. Also known as methionyl aminopeptidase and Peptidase M. Catalyzes release of N-terminal amino acids, preferentially methionine, from peptides and arylamides. Length = 238
>gnl|CDD|235576 PRK05716, PRK05716, methionine aminopeptidase; Validated Back     alignment and domain information
>gnl|CDD|215607 PLN03158, PLN03158, methionine aminopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|237252 PRK12896, PRK12896, methionine aminopeptidase; Reviewed Back     alignment and domain information
>gnl|CDD|223103 COG0024, Map, Methionine aminopeptidase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129591 TIGR00500, met_pdase_I, methionine aminopeptidase, type I Back     alignment and domain information
>gnl|CDD|215993 pfam00557, Peptidase_M24, Metallopeptidase family M24 Back     alignment and domain information
>gnl|CDD|183434 PRK12318, PRK12318, methionine aminopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|171806 PRK12897, PRK12897, methionine aminopeptidase; Reviewed Back     alignment and domain information
>gnl|CDD|238514 cd01066, APP_MetAP, A family including aminopeptidase P, aminopeptidase M, and prolidase Back     alignment and domain information
>gnl|CDD|223085 COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|238525 cd01092, APP-like, Similar to Prolidase and Aminopeptidase P Back     alignment and domain information
>gnl|CDD|181534 PRK08671, PRK08671, methionine aminopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|238521 cd01088, MetAP2, Methionine Aminopeptidase 2 Back     alignment and domain information
>gnl|CDD|129592 TIGR00501, met_pdase_II, methionine aminopeptidase, type II Back     alignment and domain information
>gnl|CDD|180918 PRK07281, PRK07281, methionine aminopeptidase; Reviewed Back     alignment and domain information
>gnl|CDD|238522 cd01089, PA2G4-like, Related to aminopepdidase M, this family contains proliferation-associated protein 2G4 Back     alignment and domain information
>gnl|CDD|182804 PRK10879, PRK10879, proline aminopeptidase P II; Provisional Back     alignment and domain information
>gnl|CDD|240246 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information
>gnl|CDD|238514 cd01066, APP_MetAP, A family including aminopeptidase P, aminopeptidase M, and prolidase Back     alignment and domain information
>gnl|CDD|129586 TIGR00495, crvDNA_42K, 42K curved DNA binding protein Back     alignment and domain information
>gnl|CDD|238520 cd01087, Prolidase, Prolidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 231
KOG2738 369 consensus Putative methionine aminopeptidase [Post 100.0
PLN03158 396 methionine aminopeptidase; Provisional 100.0
PRK12897 248 methionine aminopeptidase; Reviewed 99.96
COG0024 255 Map Methionine aminopeptidase [Translation, riboso 99.96
PRK12318 291 methionine aminopeptidase; Provisional 99.96
TIGR00500 247 met_pdase_I methionine aminopeptidase, type I. Met 99.96
PRK07281 286 methionine aminopeptidase; Reviewed 99.96
PRK12896 255 methionine aminopeptidase; Reviewed 99.95
COG0006 384 PepP Xaa-Pro aminopeptidase [Amino acid transport 99.95
PRK05716 252 methionine aminopeptidase; Validated 99.95
PRK09795 361 aminopeptidase; Provisional 99.94
PRK10879 438 proline aminopeptidase P II; Provisional 99.94
TIGR02993 391 ectoine_eutD ectoine utilization protein EutD. Mem 99.93
PRK15173 323 peptidase; Provisional 99.92
PRK14575 406 putative peptidase; Provisional 99.92
cd01090 228 Creatinase Creatine amidinohydrolase. E.C.3.5.3.3. 99.92
cd01086 238 MetAP1 Methionine Aminopeptidase 1. E.C. 3.4.11.18 99.91
PRK14576 405 putative endopeptidase; Provisional 99.91
cd01087 243 Prolidase Prolidase. E.C. 3.4.13.9. Also known as 99.91
PRK13607 443 proline dipeptidase; Provisional 99.9
cd01092208 APP-like Similar to Prolidase and Aminopeptidase P 99.9
TIGR00495 389 crvDNA_42K 42K curved DNA binding protein. Protein 99.89
cd01085 224 APP X-Prolyl Aminopeptidase 2. E.C. 3.4.11.9. Also 99.88
PF00557207 Peptidase_M24: Metallopeptidase family M24 This Pr 99.87
cd01066207 APP_MetAP A family including aminopeptidase P, ami 99.86
PTZ00053 470 methionine aminopeptidase 2; Provisional 99.86
cd01089228 PA2G4-like Related to aminopepdidase M, this famil 99.86
TIGR00501 295 met_pdase_II methionine aminopeptidase, type II. M 99.83
PRK08671 291 methionine aminopeptidase; Provisional 99.82
KOG2414 488 consensus Putative Xaa-Pro aminopeptidase [Amino a 99.81
KOG2737 492 consensus Putative metallopeptidase [General funct 99.8
cd01088 291 MetAP2 Methionine Aminopeptidase 2. E.C. 3.4.11.18 99.79
cd01091 243 CDC68-like Related to aminopeptidase P and aminope 99.74
KOG2413 606 consensus Xaa-Pro aminopeptidase [Amino acid trans 99.22
KOG2776 398 consensus Metallopeptidase [General function predi 99.19
KOG1189 960 consensus Global transcriptional regulator, cell d 98.78
KOG2775 397 consensus Metallopeptidase [General function predi 98.71
cd01066207 APP_MetAP A family including aminopeptidase P, ami 97.87
COG5406 1001 Nucleosome binding factor SPN, SPT16 subunit [Tran 97.78
cd01092208 APP-like Similar to Prolidase and Aminopeptidase P 97.67
PRK05716252 methionine aminopeptidase; Validated 97.56
cd01086238 MetAP1 Methionine Aminopeptidase 1. E.C. 3.4.11.18 97.5
PRK15173323 peptidase; Provisional 97.43
TIGR00500247 met_pdase_I methionine aminopeptidase, type I. Met 97.43
PRK14575406 putative peptidase; Provisional 97.36
cd01090228 Creatinase Creatine amidinohydrolase. E.C.3.5.3.3. 97.35
PRK14576405 putative endopeptidase; Provisional 97.3
PRK09795361 aminopeptidase; Provisional 97.26
PRK12318291 methionine aminopeptidase; Provisional 97.25
TIGR02993391 ectoine_eutD ectoine utilization protein EutD. Mem 97.23
PRK12897248 methionine aminopeptidase; Reviewed 97.21
PRK08671291 methionine aminopeptidase; Provisional 97.18
cd01091243 CDC68-like Related to aminopeptidase P and aminope 97.15
cd01088291 MetAP2 Methionine Aminopeptidase 2. E.C. 3.4.11.18 97.12
PRK12896255 methionine aminopeptidase; Reviewed 97.09
cd01087243 Prolidase Prolidase. E.C. 3.4.13.9. Also known as 96.98
PRK07281286 methionine aminopeptidase; Reviewed 96.98
PF00557207 Peptidase_M24: Metallopeptidase family M24 This Pr 96.96
PLN03158396 methionine aminopeptidase; Provisional 96.79
cd01089228 PA2G4-like Related to aminopepdidase M, this famil 96.79
TIGR00501295 met_pdase_II methionine aminopeptidase, type II. M 96.76
COG0006384 PepP Xaa-Pro aminopeptidase [Amino acid transport 96.51
COG0024255 Map Methionine aminopeptidase [Translation, riboso 96.36
TIGR00495 389 crvDNA_42K 42K curved DNA binding protein. Protein 96.31
PTZ00053470 methionine aminopeptidase 2; Provisional 96.13
PRK10879438 proline aminopeptidase P II; Provisional 95.68
cd01085224 APP X-Prolyl Aminopeptidase 2. E.C. 3.4.11.9. Also 94.43
PRK13607443 proline dipeptidase; Provisional 93.1
KOG2738369 consensus Putative methionine aminopeptidase [Post 87.0
KOG1189 960 consensus Global transcriptional regulator, cell d 83.62
>KOG2738 consensus Putative methionine aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.2e-49  Score=350.88  Aligned_cols=164  Identities=66%  Similarity=1.077  Sum_probs=155.3

Q ss_pred             CCCCccCCCcccCCCCCCCCCCCCCCCCccCCCC----CCCCC-CCCcCCHHHHHHHHHHHHHHHHHHHHHhhhcCCCCC
Q 026866           68 PNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKP----IGIVS-GPEVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGIT  142 (231)
Q Consensus        68 ~~~~~~~l~~g~~s~~~~vp~~i~~p~y~~~~~~----~~~~~-~R~VKs~~EIe~mR~Aa~ia~~~l~~~~~~i~pGvT  142 (231)
                      .|.++++||||++||++.||+||++|+|+.+|.+    +.... ...|++++||++||+||++++++++.+..+++||+|
T Consensus        69 ~~~~~g~Lr~~pvsprr~VP~hI~rPdya~~g~s~se~~~~~s~~i~i~~~e~ie~mR~ac~LarevLd~Aa~~v~PgvT  148 (369)
T KOG2738|consen   69 KFRFTGPLRPGPVSPRRPVPDHIPRPDYADSGVSLSEQPEISSNEIKILDPEGIEGMRKACRLAREVLDYAATLVRPGVT  148 (369)
T ss_pred             cccccCCccccCCCCCCcCCccCCCCchhhcCCcccccccccccceeccCHHHHHHHHHHHHHHHHHHHHHhhhcCCCcc
Confidence            4889999999999999999999999999999653    22332 467899999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCCCCCCeeeecCCCcccccCCCCCCCCCCCEEEEEEccEECCEEeceeeEEEcCCCC
Q 026866          143 TDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVD  222 (231)
Q Consensus       143 e~EI~~~v~~~~~~~Ga~ps~l~y~gFp~~v~sg~n~~~~Hg~P~~r~L~~GDiV~iDvg~~~~GY~aD~tRTf~VG~~s  222 (231)
                      ++|||+++|++++++|+|||||||.+||+++|+|+|+++|||+|+.|+||+|||||||++++++|||+|+++||+||+++
T Consensus       149 TdEiD~~VH~a~Ierg~YPSPLnYy~FPKS~CTSVNEviCHGIPD~RpLedGDIvNiDVtvY~~GyHGDlneTffvG~Vd  228 (369)
T KOG2738|consen  149 TDEIDRAVHNAIIERGAYPSPLNYYGFPKSVCTSVNEVICHGIPDSRPLEDGDIVNIDVTVYLNGYHGDLNETFFVGNVD  228 (369)
T ss_pred             HHHHHHHHHHHHHhcCCcCCCcccCCCchhhhcchhheeecCCCCcCcCCCCCEEeEEEEEEeccccCccccceEeeccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhcC
Q 026866          223 DEARNLVKG  231 (231)
Q Consensus       223 ~e~~~l~e~  231 (231)
                      ++.++|+++
T Consensus       229 e~~k~LVkv  237 (369)
T KOG2738|consen  229 EKAKKLVKV  237 (369)
T ss_pred             HHHHHHHHH
Confidence            999999863

>PLN03158 methionine aminopeptidase; Provisional Back     alignment and domain information
>PRK12897 methionine aminopeptidase; Reviewed Back     alignment and domain information
>COG0024 Map Methionine aminopeptidase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12318 methionine aminopeptidase; Provisional Back     alignment and domain information
>TIGR00500 met_pdase_I methionine aminopeptidase, type I Back     alignment and domain information
>PRK07281 methionine aminopeptidase; Reviewed Back     alignment and domain information
>PRK12896 methionine aminopeptidase; Reviewed Back     alignment and domain information
>COG0006 PepP Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05716 methionine aminopeptidase; Validated Back     alignment and domain information
>PRK09795 aminopeptidase; Provisional Back     alignment and domain information
>PRK10879 proline aminopeptidase P II; Provisional Back     alignment and domain information
>TIGR02993 ectoine_eutD ectoine utilization protein EutD Back     alignment and domain information
>PRK15173 peptidase; Provisional Back     alignment and domain information
>PRK14575 putative peptidase; Provisional Back     alignment and domain information
>cd01090 Creatinase Creatine amidinohydrolase Back     alignment and domain information
>cd01086 MetAP1 Methionine Aminopeptidase 1 Back     alignment and domain information
>PRK14576 putative endopeptidase; Provisional Back     alignment and domain information
>cd01087 Prolidase Prolidase Back     alignment and domain information
>PRK13607 proline dipeptidase; Provisional Back     alignment and domain information
>cd01092 APP-like Similar to Prolidase and Aminopeptidase P Back     alignment and domain information
>TIGR00495 crvDNA_42K 42K curved DNA binding protein Back     alignment and domain information
>cd01085 APP X-Prolyl Aminopeptidase 2 Back     alignment and domain information
>PF00557 Peptidase_M24: Metallopeptidase family M24 This Prosite entry corresponds to sub-family M24B This Prosite entry corresponds to sub-families M24A and M24C; InterPro: IPR000994 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd01066 APP_MetAP A family including aminopeptidase P, aminopeptidase M, and prolidase Back     alignment and domain information
>PTZ00053 methionine aminopeptidase 2; Provisional Back     alignment and domain information
>cd01089 PA2G4-like Related to aminopepdidase M, this family contains proliferation-associated protein 2G4 Back     alignment and domain information
>TIGR00501 met_pdase_II methionine aminopeptidase, type II Back     alignment and domain information
>PRK08671 methionine aminopeptidase; Provisional Back     alignment and domain information
>KOG2414 consensus Putative Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2737 consensus Putative metallopeptidase [General function prediction only] Back     alignment and domain information
>cd01088 MetAP2 Methionine Aminopeptidase 2 Back     alignment and domain information
>cd01091 CDC68-like Related to aminopeptidase P and aminopeptidase M, a member of this domain family is present in cell division control protein 68, a transcription factor Back     alignment and domain information
>KOG2413 consensus Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2776 consensus Metallopeptidase [General function prediction only] Back     alignment and domain information
>KOG1189 consensus Global transcriptional regulator, cell division control protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2775 consensus Metallopeptidase [General function prediction only] Back     alignment and domain information
>cd01066 APP_MetAP A family including aminopeptidase P, aminopeptidase M, and prolidase Back     alignment and domain information
>COG5406 Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] Back     alignment and domain information
>cd01092 APP-like Similar to Prolidase and Aminopeptidase P Back     alignment and domain information
>PRK05716 methionine aminopeptidase; Validated Back     alignment and domain information
>cd01086 MetAP1 Methionine Aminopeptidase 1 Back     alignment and domain information
>PRK15173 peptidase; Provisional Back     alignment and domain information
>TIGR00500 met_pdase_I methionine aminopeptidase, type I Back     alignment and domain information
>PRK14575 putative peptidase; Provisional Back     alignment and domain information
>cd01090 Creatinase Creatine amidinohydrolase Back     alignment and domain information
>PRK14576 putative endopeptidase; Provisional Back     alignment and domain information
>PRK09795 aminopeptidase; Provisional Back     alignment and domain information
>PRK12318 methionine aminopeptidase; Provisional Back     alignment and domain information
>TIGR02993 ectoine_eutD ectoine utilization protein EutD Back     alignment and domain information
>PRK12897 methionine aminopeptidase; Reviewed Back     alignment and domain information
>PRK08671 methionine aminopeptidase; Provisional Back     alignment and domain information
>cd01091 CDC68-like Related to aminopeptidase P and aminopeptidase M, a member of this domain family is present in cell division control protein 68, a transcription factor Back     alignment and domain information
>cd01088 MetAP2 Methionine Aminopeptidase 2 Back     alignment and domain information
>PRK12896 methionine aminopeptidase; Reviewed Back     alignment and domain information
>cd01087 Prolidase Prolidase Back     alignment and domain information
>PRK07281 methionine aminopeptidase; Reviewed Back     alignment and domain information
>PF00557 Peptidase_M24: Metallopeptidase family M24 This Prosite entry corresponds to sub-family M24B This Prosite entry corresponds to sub-families M24A and M24C; InterPro: IPR000994 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN03158 methionine aminopeptidase; Provisional Back     alignment and domain information
>cd01089 PA2G4-like Related to aminopepdidase M, this family contains proliferation-associated protein 2G4 Back     alignment and domain information
>TIGR00501 met_pdase_II methionine aminopeptidase, type II Back     alignment and domain information
>COG0006 PepP Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0024 Map Methionine aminopeptidase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00495 crvDNA_42K 42K curved DNA binding protein Back     alignment and domain information
>PTZ00053 methionine aminopeptidase 2; Provisional Back     alignment and domain information
>PRK10879 proline aminopeptidase P II; Provisional Back     alignment and domain information
>cd01085 APP X-Prolyl Aminopeptidase 2 Back     alignment and domain information
>PRK13607 proline dipeptidase; Provisional Back     alignment and domain information
>KOG2738 consensus Putative methionine aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1189 consensus Global transcriptional regulator, cell division control protein [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
3iu7_A 288 M. Tuberculosis Methionine Aminopeptidase With Mn I 7e-47
1y1n_A 291 Identification Of Sh3 Motif In M. Tuberculosis Meth 9e-47
3pka_A 285 M. Tuberculosis Metap With Bengamide Analog Y02, In 9e-47
3ror_A 291 Crystal Structure Of C105s Mutant Of Mycobacterium 1e-45
2b3h_A 329 Crystal Structure Of Human Methionine Aminopeptidas 3e-42
4fli_A 326 Human Metap1 With Bengamide Analog Y16, In Mn Form 1e-41
2g6p_A 304 Crystal Structure Of Truncated (Delta 1-89) Human M 2e-41
4fuk_A 337 Aminopeptidase From Trypanosoma Brucei Length = 337 4e-40
3s6b_A 368 Crystal Structure Of Methionine Aminopeptidase 1b F 3e-37
3mx6_A 262 Crystal Structure Of Methionine Aminopeptidase From 2e-30
3mr1_A 252 Crystal Structure Of Methionine Aminopeptidase From 3e-30
4mat_A 278 E.Coli Methionine Aminopeptidase His79ala Mutant Le 3e-27
2gu4_A 263 E. Coli Methionine Aminopeptidase In Complex With N 3e-27
4a6v_A 265 X-Ray Structures Of Oxazole Hydroxamate Ecmetap-Mn 4e-27
3mat_A 265 E.coli Methionine Aminopeptidase Transition-state I 4e-27
1xnz_A 264 Crystal Structure Of Mn(Ii) Form Of E. Coli. Methio 4e-27
2gg0_A 263 Novel Bacterial Methionine Aminopeptidase Inhibitor 4e-27
2p99_A 261 E. Coli Methionine Aminopeptidase Monometalated Wit 4e-27
2gtx_A 261 Structural Basis Of Catalysis By Mononuclear Methio 4e-27
2mat_A 264 E.Coli Methionine Aminopeptidase At 1.9 Angstrom Re 4e-27
1c27_A 263 E. Coli Methionine Aminopeptidase:norleucine Phosph 4e-27
2p98_A 262 E. Coli Methionine Aminopeptidase Monometalated Wit 4e-27
3tav_A 286 Crystal Structure Of A Methionine Aminopeptidase Fr 1e-19
1qxw_A 252 Crystal Structure Of Staphyloccocus Aureus In Compl 2e-19
3tb5_A 264 Crystal Structure Of The Enterococcus Faecalis Meth 2e-16
1o0x_A 262 Crystal Structure Of Methionine Aminopeptidase (Tm1 2e-14
1xgs_A 295 Methionine Aminopeptidase From Hyperthermophile Pyr 1e-10
2dfi_A 301 Crystal Structure Of Pf-Map(1-292)-C Length = 301 1e-10
3q6d_A 356 Xaa-Pro Dipeptidase From Bacillus Anthracis. Length 3e-06
2v3z_A 440 Glu383ala Escherichia Coli Aminopeptidase P In Comp 3e-05
1wl9_A 440 Structure Of Aminopeptidase P From E. Coli Length = 3e-05
2bwv_A 440 His361ala Escherichia Coli Aminopeptidase P Length 3e-05
2bwy_A 440 Glu383ala Escherichia Coli Aminopeptidase P Length 6e-05
2bww_A 440 His350ala Escherichia Coli Aminopeptidase P Length 7e-05
1m35_A 440 Aminopeptidase P From Escherichia Coli Length = 440 7e-05
1jaw_A 440 Aminopeptidase P From E. Coli Low Ph Form Length = 7e-05
2bws_A 440 His243ala Escherichia Coli Aminopeptidase P Length 4e-04
2v6c_A 353 Crystal Structure Of Erbb3 Binding Protein 1 (Ebp1) 4e-04
2bwt_A 440 Asp260ala Escherichia Coli Aminopeptidase P Length 5e-04
2bwu_A 440 Asp271ala Escherichia Coli Aminopeptidase P Length 5e-04
2bwx_A 441 His354ala Escherichia Coli Aminopeptidase P Length 7e-04
>pdb|3IU7|A Chain A, M. Tuberculosis Methionine Aminopeptidase With Mn Inhibitor A02 Length = 288 Back     alignment and structure 
Iteration: 1

 Score =  183 bits (464), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 110/159 (69%), Gaps = 3/159 (1%)
Query: 72  RKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIV-SGPEVHDEKGIECMRVSGRLAAQVL 130
           R  L PG +SP RPVP+ I RP YV   KP     S P V   + IE MRV+GR+AA  L
Sbjct: 7   RTALSPGVLSPTRPVPNWIARPEYVG--KPAAQEGSEPWVQTPEVIEKMRVAGRIAAGAL 64
Query: 131 EYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRA 190
             AG  V PG+TTDE+D+  H+ ++DNGAYPS LGY GFPKS CTS+NE ICHGIPDS  
Sbjct: 65  AEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPDSTV 124
Query: 191 LEDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLV 229
           + DGD +NIDVT Y+ G HGDT+ATF  GDV DE R LV
Sbjct: 125 ITDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLV 163
>pdb|1Y1N|A Chain A, Identification Of Sh3 Motif In M. Tuberculosis Methionine Aminopeptidase Suggests A Mode Of Interaction With The Ribosome Length = 291 Back     alignment and structure
>pdb|3PKA|A Chain A, M. Tuberculosis Metap With Bengamide Analog Y02, In Mn Form Length = 285 Back     alignment and structure
>pdb|3ROR|A Chain A, Crystal Structure Of C105s Mutant Of Mycobacterium Tuberculosis Methionine Aminopeptidase Length = 291 Back     alignment and structure
>pdb|2B3H|A Chain A, Crystal Structure Of Human Methionine Aminopeptidase Type I With A Third Cobalt In The Active Site Length = 329 Back     alignment and structure
>pdb|4FLI|A Chain A, Human Metap1 With Bengamide Analog Y16, In Mn Form Length = 326 Back     alignment and structure
>pdb|2G6P|A Chain A, Crystal Structure Of Truncated (Delta 1-89) Human Methionine Aminopeptidase Type 1 In Complex With Pyridyl Pyrimidine Derivative Length = 304 Back     alignment and structure
>pdb|4FUK|A Chain A, Aminopeptidase From Trypanosoma Brucei Length = 337 Back     alignment and structure
>pdb|3S6B|A Chain A, Crystal Structure Of Methionine Aminopeptidase 1b From Plasmodium Falciparum, Pf10_0150 Length = 368 Back     alignment and structure
>pdb|3MX6|A Chain A, Crystal Structure Of Methionine Aminopeptidase From Ricketts Prowazekii Bound To Methionine Length = 262 Back     alignment and structure
>pdb|3MR1|A Chain A, Crystal Structure Of Methionine Aminopeptidase From Ricketts Prowazekii Length = 252 Back     alignment and structure
>pdb|4MAT|A Chain A, E.Coli Methionine Aminopeptidase His79ala Mutant Length = 278 Back     alignment and structure
>pdb|2GU4|A Chain A, E. Coli Methionine Aminopeptidase In Complex With Nlep, 1: 0.5, Di-Metalated Length = 263 Back     alignment and structure
>pdb|4A6V|A Chain A, X-Ray Structures Of Oxazole Hydroxamate Ecmetap-Mn Complexes Length = 265 Back     alignment and structure
>pdb|3MAT|A Chain A, E.coli Methionine Aminopeptidase Transition-state Inhibitor Complex Length = 265 Back     alignment and structure
>pdb|1XNZ|A Chain A, Crystal Structure Of Mn(Ii) Form Of E. Coli. Methionine Aminopeptidase In Complex With 5-(2-Chlorophenyl)furan-2- Carboxylic Acid Length = 264 Back     alignment and structure
>pdb|2GG0|A Chain A, Novel Bacterial Methionine Aminopeptidase Inhibitors Length = 263 Back     alignment and structure
>pdb|2P99|A Chain A, E. Coli Methionine Aminopeptidase Monometalated With Inhibitor Ye6 Length = 261 Back     alignment and structure
>pdb|2GTX|A Chain A, Structural Basis Of Catalysis By Mononuclear Methionine Aminopeptidase Length = 261 Back     alignment and structure
>pdb|2MAT|A Chain A, E.Coli Methionine Aminopeptidase At 1.9 Angstrom Resolution Length = 264 Back     alignment and structure
>pdb|1C27|A Chain A, E. Coli Methionine Aminopeptidase:norleucine Phosphonate Complex Length = 263 Back     alignment and structure
>pdb|2P98|A Chain A, E. Coli Methionine Aminopeptidase Monometalated With Inhibitor Ye7 Length = 262 Back     alignment and structure
>pdb|3TAV|A Chain A, Crystal Structure Of A Methionine Aminopeptidase From Mycobacterium Abscessus Length = 286 Back     alignment and structure
>pdb|1QXW|A Chain A, Crystal Structure Of Staphyloccocus Aureus In Complex With An Aminoketone Inhibitor 54135. Length = 252 Back     alignment and structure
>pdb|3TB5|A Chain A, Crystal Structure Of The Enterococcus Faecalis Methionine Aminopeptidase Apo Form Length = 264 Back     alignment and structure
>pdb|1O0X|A Chain A, Crystal Structure Of Methionine Aminopeptidase (Tm1478) From Thermotoga Maritima At 1.90 A Resolution Length = 262 Back     alignment and structure
>pdb|1XGS|A Chain A, Methionine Aminopeptidase From Hyperthermophile Pyrococcus Furiosus Length = 295 Back     alignment and structure
>pdb|2DFI|A Chain A, Crystal Structure Of Pf-Map(1-292)-C Length = 301 Back     alignment and structure
>pdb|3Q6D|A Chain A, Xaa-Pro Dipeptidase From Bacillus Anthracis. Length = 356 Back     alignment and structure
>pdb|2V3Z|A Chain A, Glu383ala Escherichia Coli Aminopeptidase P In Complex With Substrate Length = 440 Back     alignment and structure
>pdb|1WL9|A Chain A, Structure Of Aminopeptidase P From E. Coli Length = 440 Back     alignment and structure
>pdb|2BWV|A Chain A, His361ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>pdb|2BWY|A Chain A, Glu383ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>pdb|2BWW|A Chain A, His350ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>pdb|1M35|A Chain A, Aminopeptidase P From Escherichia Coli Length = 440 Back     alignment and structure
>pdb|1JAW|A Chain A, Aminopeptidase P From E. Coli Low Ph Form Length = 440 Back     alignment and structure
>pdb|2BWS|A Chain A, His243ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>pdb|2V6C|A Chain A, Crystal Structure Of Erbb3 Binding Protein 1 (Ebp1) Length = 353 Back     alignment and structure
>pdb|2BWT|A Chain A, Asp260ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>pdb|2BWU|A Chain A, Asp271ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
3pka_A 285 Methionine aminopeptidase; hydrolase-hydrolase inh 1e-102
3s6b_A 368 Methionine aminopeptidase; malaria, proteolysis, " 2e-98
2b3h_A 329 Methionine aminopeptidase 1; hydrolase, metallopro 3e-96
3mx6_A 262 Methionine aminopeptidase; seattle structural geno 6e-76
2gg2_A 263 Methionine aminopeptidase; PITA-bread fold, MAP in 5e-69
1qxy_A 252 Methionyl aminopeptidase; PITA bread fold, hydrola 4e-68
3tb5_A 264 Methionine aminopeptidase; hydrolase, metalloprote 4e-64
1o0x_A 262 Methionine aminopeptidase; TM1478, structural geno 1e-61
3tav_A 286 Methionine aminopeptidase; ssgcid, seattle structu 2e-59
1xgs_A 295 Methionine aminopeptidase; hyperthermophIle; 1.75A 9e-38
2q8k_A 401 Proliferation-associated protein 2G4; EBP1, PA2G4, 4e-37
1b6a_A 478 Methionine aminopeptidase; angiogenesis inhibitor; 4e-32
2nw5_A 360 Methionine aminopeptidase 2; metap2, structural ge 2e-30
1wy2_A 351 XAA-Pro dipeptidase; structural genomics, prolidas 3e-17
2zsg_A 359 Aminopeptidase P, putative; hydrolase; 1.65A {Ther 6e-17
3q6d_A 356 Proline dipeptidase; structural genomics, csgid, c 6e-17
1wn1_A 356 Dipeptidase; prolidase, cobalt(II), structural gen 7e-17
1chm_A 401 Creatine amidinohydrolase; creatinase; 1.90A {Pseu 4e-16
4ege_A 378 Dipeptidase PEPE; structural genomics, seattle str 4e-16
1kp0_A 402 Creatine amidinohydrolase; alpha betal, 3-layer(AB 1e-15
4b28_A 470 Metallopeptidase, family M24, putative; lyase, ime 1e-09
3cb6_A 444 FACT complex subunit SPT16; peptidase homology dom 3e-09
3biq_A 467 FACT complex subunit SPT16; PITA-bread, aminopepti 1e-07
3ig4_A 427 XAA-Pro aminopeptidase; csgid, hydrolase, struct g 3e-05
2v3z_A 440 XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proli 9e-05
3l24_A 517 XAA-Pro dipeptidase; PITA-bread, detoxification, h 3e-04
>3pka_A Methionine aminopeptidase; hydrolase-hydrolase inhibitor complex; HET: Y02; 1.25A {Mycobacterium tuberculosis} PDB: 3pkb_A* 3pkc_A* 3pkd_A* 3pke_A* 3iu7_A* 3iu8_A* 3iu9_A* 1y1n_A 1yj3_A Length = 285 Back     alignment and structure
 Score =  297 bits (764), Expect = e-102
 Identities = 92/159 (57%), Positives = 108/159 (67%), Gaps = 1/159 (0%)

Query: 72  RKRLRPGKVSPHRPVPDHIPRPPYVNSQKPIGIVSGPEVHDEKGIECMRVSGRLAAQVLE 131
           R  L PG +SP RPVP+ I RP YV         S P V   + IE MRV+GR+AA  L 
Sbjct: 4   RTALSPGVLSPTRPVPNWIARPEYVGKPAAQ-EGSEPWVQTPEVIEKMRVAGRIAAGALA 62

Query: 132 YAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRAL 191
            AG  V PG+TTDE+D+  H+ ++DNGAYPS LGY GFPKS CTS+NE ICHGIPDS  +
Sbjct: 63  EAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFPKSCCTSLNEVICHGIPDSTVI 122

Query: 192 EDGDTINIDVTVYLNGYHGDTSATFFCGDVDDEARNLVK 230
            DGD +NIDVT Y+ G HGDT+ATF  GDV DE R LV 
Sbjct: 123 TDGDIVNIDVTAYIGGVHGDTNATFPAGDVADEHRLLVD 161
>3s6b_A Methionine aminopeptidase; malaria, proteolysis, "PITA bread" fold, structur genomics, structural genomics consortium, SGC, hydrolase; 1.95A {Plasmodium falciparum} Length = 368 Back     alignment and structure
>2b3h_A Methionine aminopeptidase 1; hydrolase, metalloprotease, pitab; HET: GOL; 1.10A {Homo sapiens} PDB: 2b3k_A 2b3l_A 2gz5_A* 2nq6_A* 2nq7_A* 2g6p_A* Length = 329 Back     alignment and structure
>3mx6_A Methionine aminopeptidase; seattle structural genomics center for infectious disease, S aminopeptidase, protease, epidermic typhus; 1.70A {Rickettsia prowazekii} PDB: 3mr1_A Length = 262 Back     alignment and structure
>2gg2_A Methionine aminopeptidase; PITA-bread fold, MAP inhibitor, antibacterial, hydrolase; HET: U12; 1.00A {Escherichia coli K12} SCOP: d.127.1.1 PDB: 2gg0_A* 2gg3_A* 2gg5_A* 2gg7_A* 2gg8_A* 2gg9_A* 2ggb_A* 2ggc_A 2q93_A* 2q95_A* 2q96_A* 1xnz_A* 1mat_A* 2bb7_A* 2evc_A* 2evm_A* 2evo_A* 3mat_A* 1yvm_A* 2mat_A ... Length = 263 Back     alignment and structure
>1qxy_A Methionyl aminopeptidase; PITA bread fold, hydrolase; HET: M2C; 1.04A {Staphylococcus aureus} SCOP: d.127.1.1 PDB: 1qxw_A* 1qxz_A* Length = 252 Back     alignment and structure
>3tb5_A Methionine aminopeptidase; hydrolase, metalloprotease, enter feacalis; HET: CIT; 2.30A {Enterococcus faecalis} Length = 264 Back     alignment and structure
>1o0x_A Methionine aminopeptidase; TM1478, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Thermotoga maritima} SCOP: d.127.1.1 Length = 262 Back     alignment and structure
>3tav_A Methionine aminopeptidase; ssgcid, seattle structural genomics center for infectious DI protease, hydrolase; 2.15A {Mycobacterium abscessus} Length = 286 Back     alignment and structure
>1xgs_A Methionine aminopeptidase; hyperthermophIle; 1.75A {Pyrococcus furiosus} SCOP: a.4.5.25 d.127.1.1 PDB: 1xgm_A 1xgn_A 1xgo_A 1wkm_A 2dfi_A Length = 295 Back     alignment and structure
>2q8k_A Proliferation-associated protein 2G4; EBP1, PA2G4, methionine aminopeptidase, PITA-bread, transcri; 1.60A {Homo sapiens} PDB: 2v6c_A Length = 401 Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 Back     alignment and structure
>1wy2_A XAA-Pro dipeptidase; structural genomics, prolidase, riken structural genomics/PR initiative, RSGI, hydrolase; 1.70A {Pyrococcus horikoshii} PDB: 1pv9_A Length = 351 Back     alignment and structure
>2zsg_A Aminopeptidase P, putative; hydrolase; 1.65A {Thermotoga maritima} Length = 359 Back     alignment and structure
>3q6d_A Proline dipeptidase; structural genomics, csgid, center for structural genomics O infectious diseases, aminopeptidase, viral protein; 1.97A {Bacillus anthracis} Length = 356 Back     alignment and structure
>1wn1_A Dipeptidase; prolidase, cobalt(II), structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; 2.25A {Pyrococcus horikoshii} PDB: 2how_A Length = 356 Back     alignment and structure
>1chm_A Creatine amidinohydrolase; creatinase; 1.90A {Pseudomonas putida} SCOP: c.55.2.1 d.127.1.1 Length = 401 Back     alignment and structure
>4ege_A Dipeptidase PEPE; structural genomics, seattle structural genomics center for infectious disease, ssgcid, hydrolase; 2.20A {Mycobacterium ulcerans} Length = 378 Back     alignment and structure
>1kp0_A Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sandwich; 2.70A {Actinobacillus} SCOP: c.55.2.1 d.127.1.1 Length = 402 Back     alignment and structure
>4b28_A Metallopeptidase, family M24, putative; lyase, imethylsulfonioproionate, acrylate, dimethylsulfide; 2.15A {Roseobacter denitrificans och 114} Length = 470 Back     alignment and structure
>3cb6_A FACT complex subunit SPT16; peptidase homology domain, histone binding module, histone H chaperone, PITA-bread fold; 1.84A {Schizosaccharomyces pombe} PDB: 3cb5_A Length = 444 Back     alignment and structure
>3biq_A FACT complex subunit SPT16; PITA-bread, aminopeptidase, chromatin, replication, AC chromosomal protein, DNA damage, DNA repair; 1.73A {Saccharomyces cerevisiae} PDB: 3bip_A 3bit_A* Length = 467 Back     alignment and structure
>3ig4_A XAA-Pro aminopeptidase; csgid, hydrolase, struct genomics, center for structural genomics of infectious DISE; HET: SO4; 2.89A {Bacillus anthracis} Length = 427 Back     alignment and structure
>2v3z_A XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- specific enzyme, aminopeptidas manganese enzyme, protease, manganese; HET: CSO; 1.56A {Escherichia coli} SCOP: c.55.2.1 d.127.1.1 PDB: 2bwy_A* 1wl9_A 1m35_A 1n51_A* 1w2m_A 1a16_A 1wbq_A 1wl6_A* 1w7v_A 1wlr_A* 2bh3_A* 2bha_A* 2bhb_A* 2bhc_A* 2bhd_A* 2bn7_A* 1jaw_A 2bwt_A* 2bwu_A* 2bww_A* ... Length = 440 Back     alignment and structure
>3l24_A XAA-Pro dipeptidase; PITA-bread, detoxification, hydrolase, manganese, metal-binding, metalloprotease, protease; 2.30A {Alteromonas SP} PDB: 3l7g_A* Length = 517 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
4fuk_A 337 Methionine aminopeptidase; structural genomics con 100.0
3s6b_A 368 Methionine aminopeptidase; malaria, proteolysis, " 100.0
2b3h_A 329 Methionine aminopeptidase 1; hydrolase, metallopro 100.0
3pka_A 285 Methionine aminopeptidase; hydrolase-hydrolase inh 100.0
3tb5_A 264 Methionine aminopeptidase; hydrolase, metalloprote 99.98
3mx6_A 262 Methionine aminopeptidase; seattle structural geno 99.97
1o0x_A 262 Methionine aminopeptidase; TM1478, structural geno 99.97
3tav_A 286 Methionine aminopeptidase; ssgcid, seattle structu 99.97
2gg2_A 263 Methionine aminopeptidase; PITA-bread fold, MAP in 99.97
1qxy_A 252 Methionyl aminopeptidase; PITA bread fold, hydrola 99.96
3q6d_A 356 Proline dipeptidase; structural genomics, csgid, c 99.95
2zsg_A 359 Aminopeptidase P, putative; hydrolase; 1.65A {Ther 99.95
1wy2_A 351 XAA-Pro dipeptidase; structural genomics, prolidas 99.95
1wn1_A 356 Dipeptidase; prolidase, cobalt(II), structural gen 99.95
3ig4_A 427 XAA-Pro aminopeptidase; csgid, hydrolase, struct g 99.95
3fm3_A 358 Methionine aminopeptidase 2; metap2, structural ge 99.95
4fkc_A 377 XAA-Pro aminopeptidase; PITA-bread structure, prol 99.95
2v3z_A 440 XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proli 99.94
4ege_A 378 Dipeptidase PEPE; structural genomics, seattle str 99.94
2q8k_A 401 Proliferation-associated protein 2G4; EBP1, PA2G4, 99.94
1kp0_A 402 Creatine amidinohydrolase; alpha betal, 3-layer(AB 99.94
2iw2_A 494 XAA-Pro dipeptidase; metallocarboxypeptidase, dise 99.93
3rva_A 451 Organophosphorus acid anhydrolase; PITA-bread fold 99.93
1chm_A 401 Creatine amidinohydrolase; creatinase; 1.90A {Pseu 99.92
4b28_A 470 Metallopeptidase, family M24, putative; lyase, ime 99.91
3biq_A 467 FACT complex subunit SPT16; PITA-bread, aminopepti 99.91
3l24_A 517 XAA-Pro dipeptidase; PITA-bread, detoxification, h 99.91
3cb6_A 444 FACT complex subunit SPT16; peptidase homology dom 99.91
1xgs_A 295 Methionine aminopeptidase; hyperthermophIle; 1.75A 99.9
2nw5_A 360 Methionine aminopeptidase 2; metap2, structural ge 99.9
3ctz_A 623 XAA-Pro aminopeptidase 1; PITA-bread fold, alterna 99.88
1b6a_A 478 Methionine aminopeptidase; angiogenesis inhibitor; 99.86
4b6a_t 614 Probable metalloprotease ARX1; large ribosomal sub 99.54
3q6d_A356 Proline dipeptidase; structural genomics, csgid, c 97.35
4ege_A378 Dipeptidase PEPE; structural genomics, seattle str 97.24
1wy2_A351 XAA-Pro dipeptidase; structural genomics, prolidas 97.17
2zsg_A359 Aminopeptidase P, putative; hydrolase; 1.65A {Ther 97.17
1wn1_A356 Dipeptidase; prolidase, cobalt(II), structural gen 97.13
1o0x_A262 Methionine aminopeptidase; TM1478, structural geno 97.01
3mx6_A262 Methionine aminopeptidase; seattle structural geno 96.99
2gg2_A263 Methionine aminopeptidase; PITA-bread fold, MAP in 96.97
3pka_A285 Methionine aminopeptidase; hydrolase-hydrolase inh 96.9
1qxy_A252 Methionyl aminopeptidase; PITA bread fold, hydrola 96.89
3cb6_A444 FACT complex subunit SPT16; peptidase homology dom 96.79
4fkc_A377 XAA-Pro aminopeptidase; PITA-bread structure, prol 96.74
1kp0_A402 Creatine amidinohydrolase; alpha betal, 3-layer(AB 96.72
3tb5_A264 Methionine aminopeptidase; hydrolase, metalloprote 96.71
3tav_A286 Methionine aminopeptidase; ssgcid, seattle structu 96.61
3biq_A467 FACT complex subunit SPT16; PITA-bread, aminopepti 96.61
3ig4_A427 XAA-Pro aminopeptidase; csgid, hydrolase, struct g 96.46
1chm_A401 Creatine amidinohydrolase; creatinase; 1.90A {Pseu 96.39
2b3h_A329 Methionine aminopeptidase 1; hydrolase, metallopro 96.34
1xgs_A295 Methionine aminopeptidase; hyperthermophIle; 1.75A 96.32
2v3z_A440 XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proli 96.29
3s6b_A368 Methionine aminopeptidase; malaria, proteolysis, " 96.25
2q8k_A 401 Proliferation-associated protein 2G4; EBP1, PA2G4, 95.66
2nw5_A360 Methionine aminopeptidase 2; metap2, structural ge 95.51
3rva_A451 Organophosphorus acid anhydrolase; PITA-bread fold 94.88
3ctz_A623 XAA-Pro aminopeptidase 1; PITA-bread fold, alterna 94.86
4fuk_A337 Methionine aminopeptidase; structural genomics con 94.81
4b28_A470 Metallopeptidase, family M24, putative; lyase, ime 94.67
1b6a_A478 Methionine aminopeptidase; angiogenesis inhibitor; 94.64
3l24_A 517 XAA-Pro dipeptidase; PITA-bread, detoxification, h 94.46
2iw2_A494 XAA-Pro dipeptidase; metallocarboxypeptidase, dise 93.89
3fm3_A358 Methionine aminopeptidase 2; metap2, structural ge 86.63
>4fuk_A Methionine aminopeptidase; structural genomics consortium, SGC, hydrolase; 1.75A {Trypanosoma brucei brucei} Back     alignment and structure
Probab=100.00  E-value=2.2e-41  Score=307.66  Aligned_cols=163  Identities=48%  Similarity=0.836  Sum_probs=151.5

Q ss_pred             CCCCccCCCcccCCCCCCCCCCCCCCCCccCCCCC----------------CCCCCCCcCCHHHHHHHHHHHHHHHHHHH
Q 026866           68 PNRRRKRLRPGKVSPHRPVPDHIPRPPYVNSQKPI----------------GIVSGPEVHDEKGIECMRVSGRLAAQVLE  131 (231)
Q Consensus        68 ~~~~~~~l~~g~~s~~~~vp~~i~~p~y~~~~~~~----------------~~~~~R~VKs~~EIe~mR~Aa~ia~~~l~  131 (231)
                      +|.|+|+||||++||++.||+||++|+|+......                .....|.|||++||++||+||+|++++++
T Consensus         5 ~~~~~g~~~p~~~sp~~~vP~~i~~p~y~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~VKs~~EI~~mR~A~~i~~~a~~   84 (337)
T 4fuk_A            5 TFDFTGPLRPGKITPRRAVPSHILRPDYADRAGGVSASEEKDRGSKVKVYNIQFLHDDSKKTAEIQRIKTVCQLSREVLD   84 (337)
T ss_dssp             CCCCCSSCCCCCCCCCCCCCTTSCCCTTSSSTTCCCHHHHHHTTCCCCCCCCTTTTCTTC--CHHHHHHHHHHHHHHHHH
T ss_pred             CcceecccccccCCCCCCCCCCCCCCCcccCCCCCCccccccccCccccccchhhcccCCCHHHHHHHHHHHHHHHHHHH
Confidence            58999999999999999999999999999653211                12346899999999999999999999999


Q ss_pred             HHhhhcCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCeeeecCCCcccccCCCCCCCCCCCEEEEEEccEECCEEec
Q 026866          132 YAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPDSRALEDGDTINIDVTVYLNGYHGD  211 (231)
Q Consensus       132 ~~~~~i~pGvTe~EI~~~v~~~~~~~Ga~ps~l~y~gFp~~v~sg~n~~~~Hg~P~~r~L~~GDiV~iDvg~~~~GY~aD  211 (231)
                      .+.+.++||+||.||++.+++++.++|+++++.+|.+|++++|+|.|+++||++|++++|++||+|++|+|+.++||++|
T Consensus        85 ~~~~~ikpG~te~el~~~~~~~~~~~g~~~~~~~~~~fp~iv~~g~n~~~~H~~~~~~~l~~GD~v~iD~g~~~~GY~sD  164 (337)
T 4fuk_A           85 IATAAAKPGITTDELDRIVHEATVERNMYPSPLNYYGFPKSVCTSVNEVICHGIPDSRELEEGDILNIDVSSYLNGFHGD  164 (337)
T ss_dssp             HHHHHCCTTCBHHHHHHHHHHHHHHTTCEETTTTGGGCCSSSEEEETTEEECCCCCSCBCCTTCEEEEEEEEEETTEEEE
T ss_pred             HHHHHccCCCCHHHHHHHHHHHHHHcCCCccCCCCCCcCceeeccccccccCCCCCCccccCCCEEEEecceeECCEEEe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeEEEcCCCCHHHHHhhc
Q 026866          212 TSATFFCGDVDDEARNLVK  230 (231)
Q Consensus       212 ~tRTf~VG~~s~e~~~l~e  230 (231)
                      +||||++|+++++++++|+
T Consensus       165 ~tRT~~vG~~~~~~~~l~~  183 (337)
T 4fuk_A          165 LNETVFIGRPDDDSVRLVH  183 (337)
T ss_dssp             EEEEEESSSCCHHHHHHHH
T ss_pred             eeeeEEeCCccHHHHHHHH
Confidence            9999999999999999986
>3s6b_A Methionine aminopeptidase; malaria, proteolysis, "PITA bread" fold, structur genomics, structural genomics consortium, SGC, hydrolase; 1.95A {Plasmodium falciparum} Back     alignment and structure
>2b3h_A Methionine aminopeptidase 1; hydrolase, metalloprotease, pitab; HET: GOL; 1.10A {Homo sapiens} PDB: 2b3k_A 2b3l_A 2gz5_A* 2nq6_A* 2nq7_A* 2g6p_A* Back     alignment and structure
>3pka_A Methionine aminopeptidase; hydrolase-hydrolase inhibitor complex; HET: Y02; 1.25A {Mycobacterium tuberculosis} PDB: 3pkb_A* 3pkc_A* 3pkd_A* 3pke_A* 3iu7_A* 3iu8_A* 3iu9_A* 1y1n_A 1yj3_A 3ror_A Back     alignment and structure
>3tb5_A Methionine aminopeptidase; hydrolase, metalloprotease, enter feacalis; HET: CIT; 2.30A {Enterococcus faecalis} Back     alignment and structure
>3mx6_A Methionine aminopeptidase; seattle structural genomics center for infectious disease, S aminopeptidase, protease, epidermic typhus; 1.70A {Rickettsia prowazekii} PDB: 3mr1_A Back     alignment and structure
>1o0x_A Methionine aminopeptidase; TM1478, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Thermotoga maritima} SCOP: d.127.1.1 Back     alignment and structure
>3tav_A Methionine aminopeptidase; ssgcid, seattle structural genomics center for infectious DI protease, hydrolase; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>2gg2_A Methionine aminopeptidase; PITA-bread fold, MAP inhibitor, antibacterial, hydrolase; HET: U12; 1.00A {Escherichia coli K12} SCOP: d.127.1.1 PDB: 2gg0_A* 2gg3_A* 2gg5_A* 2gg7_A* 2gg8_A* 2gg9_A* 2ggb_A* 2ggc_A 2q93_A* 2q95_A* 2q96_A* 1xnz_A* 1mat_A* 2bb7_A* 2evc_A* 2evm_A* 2evo_A* 3mat_A* 1yvm_A* 2mat_A ... Back     alignment and structure
>1qxy_A Methionyl aminopeptidase; PITA bread fold, hydrolase; HET: M2C; 1.04A {Staphylococcus aureus} SCOP: d.127.1.1 PDB: 1qxw_A* 1qxz_A* Back     alignment and structure
>3q6d_A Proline dipeptidase; structural genomics, csgid, center for structural genomics O infectious diseases, aminopeptidase, viral protein; 1.97A {Bacillus anthracis} Back     alignment and structure
>2zsg_A Aminopeptidase P, putative; hydrolase; 1.65A {Thermotoga maritima} Back     alignment and structure
>1wy2_A XAA-Pro dipeptidase; structural genomics, prolidase, riken structural genomics/PR initiative, RSGI, hydrolase; 1.70A {Pyrococcus horikoshii} PDB: 1pv9_A Back     alignment and structure
>1wn1_A Dipeptidase; prolidase, cobalt(II), structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; 2.25A {Pyrococcus horikoshii} PDB: 2how_A Back     alignment and structure
>3ig4_A XAA-Pro aminopeptidase; csgid, hydrolase, struct genomics, center for structural genomics of infectious DISE; HET: SO4; 2.89A {Bacillus anthracis} Back     alignment and structure
>3fm3_A Methionine aminopeptidase 2; metap2, structural genomics, PSI-2, protein structure initiative; 2.18A {Encephalitozoon cuniculi} PDB: 3fmq_A* 3fmr_A* Back     alignment and structure
>4fkc_A XAA-Pro aminopeptidase; PITA-bread structure, prolidase, hydrolase; 2.60A {Thermococcus sibiricus} Back     alignment and structure
>2v3z_A XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- specific enzyme, aminopeptidas manganese enzyme, protease, manganese; HET: CSO; 1.56A {Escherichia coli} SCOP: c.55.2.1 d.127.1.1 PDB: 2bwy_A* 1wl9_A 1m35_A 1n51_A* 1w2m_A 1a16_A 1wbq_A 1wl6_A* 1w7v_A 1wlr_A* 2bh3_A* 2bha_A* 2bhb_A* 2bhc_A* 2bhd_A* 2bn7_A* 1jaw_A 2bwt_A* 2bwu_A* 2bww_A* ... Back     alignment and structure
>4ege_A Dipeptidase PEPE; structural genomics, seattle structural genomics center for infectious disease, ssgcid, hydrolase; 2.20A {Mycobacterium ulcerans} Back     alignment and structure
>2q8k_A Proliferation-associated protein 2G4; EBP1, PA2G4, methionine aminopeptidase, PITA-bread, transcri; 1.60A {Homo sapiens} PDB: 2v6c_A Back     alignment and structure
>1kp0_A Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sandwich; 2.70A {Actinobacillus} SCOP: c.55.2.1 d.127.1.1 Back     alignment and structure
>2iw2_A XAA-Pro dipeptidase; metallocarboxypeptidase, disease mutation, XAA-Pro dipeptida dipeptidase, peptidase D, collagen degradation; 1.82A {Homo sapiens} PDB: 2okn_A Back     alignment and structure
>3rva_A Organophosphorus acid anhydrolase; PITA-bread fold, binuclea center, BI-functional, prolidase, nerve agents, XAA-Pro DIP hydrolase; 1.80A {Alteromonas macleodii} Back     alignment and structure
>1chm_A Creatine amidinohydrolase; creatinase; 1.90A {Pseudomonas putida} SCOP: c.55.2.1 d.127.1.1 Back     alignment and structure
>4b28_A Metallopeptidase, family M24, putative; lyase, imethylsulfonioproionate, acrylate, dimethylsulfide; 2.15A {Roseobacter denitrificans och 114} Back     alignment and structure
>3biq_A FACT complex subunit SPT16; PITA-bread, aminopeptidase, chromatin, replication, AC chromosomal protein, DNA damage, DNA repair; 1.73A {Saccharomyces cerevisiae} PDB: 3bip_A 3bit_A* Back     alignment and structure
>3l24_A XAA-Pro dipeptidase; PITA-bread, detoxification, hydrolase, manganese, metal-binding, metalloprotease, protease; 2.30A {Alteromonas SP} PDB: 3l7g_A* Back     alignment and structure
>3cb6_A FACT complex subunit SPT16; peptidase homology domain, histone binding module, histone H chaperone, PITA-bread fold; 1.84A {Schizosaccharomyces pombe} PDB: 3cb5_A Back     alignment and structure
>1xgs_A Methionine aminopeptidase; hyperthermophIle; 1.75A {Pyrococcus furiosus} SCOP: a.4.5.25 d.127.1.1 PDB: 1xgm_A 1xgn_A 1xgo_A 1wkm_A 2dfi_A Back     alignment and structure
>3ctz_A XAA-Pro aminopeptidase 1; PITA-bread fold, alternative splicing, cytoplasm, hydrolase, manganese, metal-binding, metalloprotease, protease; HET: P6G; 1.60A {Homo sapiens} Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Back     alignment and structure
>4b6a_t Probable metalloprotease ARX1; large ribosomal subunit, ribosome biogenesis, ribosome matur factor, ribosome; 8.10A {Saccharomyces cerevisiae} Back     alignment and structure
>3q6d_A Proline dipeptidase; structural genomics, csgid, center for structural genomics O infectious diseases, aminopeptidase, viral protein; 1.97A {Bacillus anthracis} Back     alignment and structure
>4ege_A Dipeptidase PEPE; structural genomics, seattle structural genomics center for infectious disease, ssgcid, hydrolase; 2.20A {Mycobacterium ulcerans} Back     alignment and structure
>1wy2_A XAA-Pro dipeptidase; structural genomics, prolidase, riken structural genomics/PR initiative, RSGI, hydrolase; 1.70A {Pyrococcus horikoshii} PDB: 1pv9_A Back     alignment and structure
>2zsg_A Aminopeptidase P, putative; hydrolase; 1.65A {Thermotoga maritima} Back     alignment and structure
>1wn1_A Dipeptidase; prolidase, cobalt(II), structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; 2.25A {Pyrococcus horikoshii} PDB: 2how_A Back     alignment and structure
>1o0x_A Methionine aminopeptidase; TM1478, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Thermotoga maritima} SCOP: d.127.1.1 Back     alignment and structure
>3mx6_A Methionine aminopeptidase; seattle structural genomics center for infectious disease, S aminopeptidase, protease, epidermic typhus; 1.70A {Rickettsia prowazekii} PDB: 3mr1_A Back     alignment and structure
>2gg2_A Methionine aminopeptidase; PITA-bread fold, MAP inhibitor, antibacterial, hydrolase; HET: U12; 1.00A {Escherichia coli K12} SCOP: d.127.1.1 PDB: 2gg0_A* 2gg3_A* 2gg5_A* 2gg7_A* 2gg8_A* 2gg9_A* 2ggb_A* 2ggc_A 2q93_A* 2q95_A* 2q96_A* 1xnz_A* 1mat_A* 2bb7_A* 2evc_A* 2evm_A* 2evo_A* 3mat_A* 1yvm_A* 2mat_A ... Back     alignment and structure
>3pka_A Methionine aminopeptidase; hydrolase-hydrolase inhibitor complex; HET: Y02; 1.25A {Mycobacterium tuberculosis} PDB: 3pkb_A* 3pkc_A* 3pkd_A* 3pke_A* 3iu7_A* 3iu8_A* 3iu9_A* 1y1n_A 1yj3_A 3ror_A Back     alignment and structure
>1qxy_A Methionyl aminopeptidase; PITA bread fold, hydrolase; HET: M2C; 1.04A {Staphylococcus aureus} SCOP: d.127.1.1 PDB: 1qxw_A* 1qxz_A* Back     alignment and structure
>3cb6_A FACT complex subunit SPT16; peptidase homology domain, histone binding module, histone H chaperone, PITA-bread fold; 1.84A {Schizosaccharomyces pombe} PDB: 3cb5_A Back     alignment and structure
>4fkc_A XAA-Pro aminopeptidase; PITA-bread structure, prolidase, hydrolase; 2.60A {Thermococcus sibiricus} Back     alignment and structure
>1kp0_A Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sandwich; 2.70A {Actinobacillus} SCOP: c.55.2.1 d.127.1.1 Back     alignment and structure
>3tb5_A Methionine aminopeptidase; hydrolase, metalloprotease, enter feacalis; HET: CIT; 2.30A {Enterococcus faecalis} Back     alignment and structure
>3tav_A Methionine aminopeptidase; ssgcid, seattle structural genomics center for infectious DI protease, hydrolase; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3biq_A FACT complex subunit SPT16; PITA-bread, aminopeptidase, chromatin, replication, AC chromosomal protein, DNA damage, DNA repair; 1.73A {Saccharomyces cerevisiae} PDB: 3bip_A 3bit_A* Back     alignment and structure
>3ig4_A XAA-Pro aminopeptidase; csgid, hydrolase, struct genomics, center for structural genomics of infectious DISE; HET: SO4; 2.89A {Bacillus anthracis} Back     alignment and structure
>1chm_A Creatine amidinohydrolase; creatinase; 1.90A {Pseudomonas putida} SCOP: c.55.2.1 d.127.1.1 Back     alignment and structure
>2b3h_A Methionine aminopeptidase 1; hydrolase, metalloprotease, pitab; HET: GOL; 1.10A {Homo sapiens} PDB: 2b3k_A 2b3l_A 2gz5_A* 2nq6_A* 2nq7_A* 2g6p_A* Back     alignment and structure
>1xgs_A Methionine aminopeptidase; hyperthermophIle; 1.75A {Pyrococcus furiosus} SCOP: a.4.5.25 d.127.1.1 PDB: 1xgm_A 1xgn_A 1xgo_A 1wkm_A 2dfi_A Back     alignment and structure
>2v3z_A XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- specific enzyme, aminopeptidas manganese enzyme, protease, manganese; HET: CSO; 1.56A {Escherichia coli} SCOP: c.55.2.1 d.127.1.1 PDB: 2bwy_A* 1wl9_A 1m35_A 1n51_A* 1w2m_A 1a16_A 1wbq_A 1wl6_A* 1w7v_A 1wlr_A* 2bh3_A* 2bha_A* 2bhb_A* 2bhc_A* 2bhd_A* 2bn7_A* 1jaw_A 2bwt_A* 2bwu_A* 2bww_A* ... Back     alignment and structure
>3s6b_A Methionine aminopeptidase; malaria, proteolysis, "PITA bread" fold, structur genomics, structural genomics consortium, SGC, hydrolase; 1.95A {Plasmodium falciparum} Back     alignment and structure
>2q8k_A Proliferation-associated protein 2G4; EBP1, PA2G4, methionine aminopeptidase, PITA-bread, transcri; 1.60A {Homo sapiens} PDB: 2v6c_A Back     alignment and structure
>3rva_A Organophosphorus acid anhydrolase; PITA-bread fold, binuclea center, BI-functional, prolidase, nerve agents, XAA-Pro DIP hydrolase; 1.80A {Alteromonas macleodii} Back     alignment and structure
>3ctz_A XAA-Pro aminopeptidase 1; PITA-bread fold, alternative splicing, cytoplasm, hydrolase, manganese, metal-binding, metalloprotease, protease; HET: P6G; 1.60A {Homo sapiens} Back     alignment and structure
>4fuk_A Methionine aminopeptidase; structural genomics consortium, SGC, hydrolase; 1.75A {Trypanosoma brucei brucei} Back     alignment and structure
>4b28_A Metallopeptidase, family M24, putative; lyase, imethylsulfonioproionate, acrylate, dimethylsulfide; 2.15A {Roseobacter denitrificans och 114} Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Back     alignment and structure
>3l24_A XAA-Pro dipeptidase; PITA-bread, detoxification, hydrolase, manganese, metal-binding, metalloprotease, protease; 2.30A {Alteromonas SP} PDB: 3l7g_A* Back     alignment and structure
>2iw2_A XAA-Pro dipeptidase; metallocarboxypeptidase, disease mutation, XAA-Pro dipeptida dipeptidase, peptidase D, collagen degradation; 1.82A {Homo sapiens} PDB: 2okn_A Back     alignment and structure
>3fm3_A Methionine aminopeptidase 2; metap2, structural genomics, PSI-2, protein structure initiative; 2.18A {Encephalitozoon cuniculi} PDB: 3fmq_A* 3fmr_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 231
d2gg2a1 262 d.127.1.1 (A:3-264) Methionine aminopeptidase {Esc 8e-28
d1b6aa2 295 d.127.1.1 (A:110-374,A:449-478) Methionine aminope 7e-21
d1qxya_ 249 d.127.1.1 (A:) Methionine aminopeptidase {Staphylo 1e-17
d2v3za2 264 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal 2e-16
d1chma2 246 d.127.1.1 (A:157-402) Creatinase, catalytic (C-ter 4e-16
d1xgsa2 218 d.127.1.1 (A:1-194,A:272-295) Methionine aminopept 1e-15
d1o0xa_ 249 d.127.1.1 (A:) Methionine aminopeptidase {Thermoto 4e-15
d1pv9a2 221 d.127.1.1 (A:125-345) Aminopeptidase P, C-terminal 2e-11
>d2gg2a1 d.127.1.1 (A:3-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} Length = 262 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Creatinase/aminopeptidase
superfamily: Creatinase/aminopeptidase
family: Creatinase/aminopeptidase
domain: Methionine aminopeptidase
species: Escherichia coli [TaxId: 562]

 Score =  104 bits (260), Expect = 8e-28
 Identities = 58/115 (50%), Positives = 79/115 (68%), Gaps = 2/115 (1%)

Query: 109 EVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMII-DNGAYPSPLGYG 167
            +   + IE MRV+GRLAA+VLE     VKPG++T E+D+  +  I+ +  A  + LGY 
Sbjct: 2   SIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYH 61

Query: 168 GFPKSVCTSVNECICHGIP-DSRALEDGDTINIDVTVYLNGYHGDTSATFFCGDV 221
           G+PKSVC S+NE +CHGIP D++ L+DGD +NIDVTV  +G+HGDTS  F  G  
Sbjct: 62  GYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKP 116
>d1b6aa2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]} Length = 295 Back     information, alignment and structure
>d1qxya_ d.127.1.1 (A:) Methionine aminopeptidase {Staphylococcus aureus [TaxId: 1280]} Length = 249 Back     information, alignment and structure
>d2v3za2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 264 Back     information, alignment and structure
>d1chma2 d.127.1.1 (A:157-402) Creatinase, catalytic (C-terminal) domain {Pseudomonas putida [TaxId: 303]} Length = 246 Back     information, alignment and structure
>d1xgsa2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 218 Back     information, alignment and structure
>d1o0xa_ d.127.1.1 (A:) Methionine aminopeptidase {Thermotoga maritima [TaxId: 2336]} Length = 249 Back     information, alignment and structure
>d1pv9a2 d.127.1.1 (A:125-345) Aminopeptidase P, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
d1qxya_ 249 Methionine aminopeptidase {Staphylococcus aureus [ 99.94
d1o0xa_ 249 Methionine aminopeptidase {Thermotoga maritima [Ta 99.94
d1pv9a2 221 Aminopeptidase P, C-terminal domain {Archaeon Pyro 99.94
d2gg2a1 262 Methionine aminopeptidase {Escherichia coli [TaxId 99.93
d1chma2 246 Creatinase, catalytic (C-terminal) domain {Pseudom 99.93
d2v3za2 264 Aminopeptidase P, C-terminal domain {Escherichia c 99.92
d1b6aa2 295 Methionine aminopeptidase {Human (Homo sapiens) [T 99.9
d1xgsa2 218 Methionine aminopeptidase {Archaeon Pyrococcus fur 99.87
d1pv9a2221 Aminopeptidase P, C-terminal domain {Archaeon Pyro 97.58
d1xgsa2218 Methionine aminopeptidase {Archaeon Pyrococcus fur 96.95
d1chma2246 Creatinase, catalytic (C-terminal) domain {Pseudom 96.91
d2gg2a1262 Methionine aminopeptidase {Escherichia coli [TaxId 96.81
d1qxya_249 Methionine aminopeptidase {Staphylococcus aureus [ 96.41
d1o0xa_249 Methionine aminopeptidase {Thermotoga maritima [Ta 96.3
d2v3za2264 Aminopeptidase P, C-terminal domain {Escherichia c 94.9
d1b6aa2295 Methionine aminopeptidase {Human (Homo sapiens) [T 91.43
>d1qxya_ d.127.1.1 (A:) Methionine aminopeptidase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Creatinase/aminopeptidase
superfamily: Creatinase/aminopeptidase
family: Creatinase/aminopeptidase
domain: Methionine aminopeptidase
species: Staphylococcus aureus [TaxId: 1280]

Probab=99.94  E-value=1e-27  Score=204.08  Aligned_cols=123  Identities=35%  Similarity=0.629  Sum_probs=114.1

Q ss_pred             CCcCCHHHHHHHHHHHHHHHHHHHHHhhhcCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCeeeecCCCcccccCCC
Q 026866          108 PEVHDEKGIECMRVSGRLAAQVLEYAGTLVKPGITTDEIDKAVHQMIIDNGAYPSPLGYGGFPKSVCTSVNECICHGIPD  187 (231)
Q Consensus       108 R~VKs~~EIe~mR~Aa~ia~~~l~~~~~~i~pGvTe~EI~~~v~~~~~~~Ga~ps~l~y~gFp~~v~sg~n~~~~Hg~P~  187 (231)
                      .+|||++||+.||+|++|++++++++.+.++||+||.||++.+++.+.++|+.+.+.++.+|+.++|+|.|...+|+.|+
T Consensus         1 ~~IKs~~Ei~~~R~A~~i~~~~~~~~~~~i~~G~se~ei~~~~~~~~~~~~a~~~~~~~~~~~~~~~~g~~~~~~h~~~~   80 (249)
T d1qxya_           1 MIVKTEEELQALKEIGYICAKVRNTMQAATKPGITTKELDNIAKELFEEYGAISAPIHDENFPGQTCISVNEEVAHGIPS   80 (249)
T ss_dssp             CBCCSHHHHHHHHHHHHHHHHHHHHHHHHCCTTCBHHHHHHHHHHHHHHHTCEEHHHHHHCCSSSSEEEETTEEECCCCC
T ss_pred             CEeCCHHHHHHHHHHHHHHHHHHHHHHHHCcCCCcHHHHHHHHHHHHHHhhhhhcccccccccccccccccccccccccC
Confidence            37999999999999999999999999999999999999999999999999987765556779999999999999999999


Q ss_pred             CCCCCCCCEEEEEEccEECCEEeceeeEEEcCCCCH-HHHHhhc
Q 026866          188 SRALEDGDTINIDVTVYLNGYHGDTSATFFCGDVDD-EARNLVK  230 (231)
Q Consensus       188 ~r~L~~GDiV~iDvg~~~~GY~aD~tRTf~VG~~s~-e~~~l~e  230 (231)
                      +++|++||+|.+|+++.++||++|++|||++|++++ +++++++
T Consensus        81 ~~~l~~Gd~v~id~g~~~~gY~~d~~Rt~~~G~~~~~~~~~~~~  124 (249)
T d1qxya_          81 KRVIREGDLVNIDVSALKNGYYADTGISFVVGESDDPMKQKVCD  124 (249)
T ss_dssp             SCBCCTTCEEEEEEEEEETTEEEEEEEEEECSCCSCTHHHHHHH
T ss_pred             CceecCCCceEEeeeeEECCEecccccccccCCCcchhhhHHHH
Confidence            999999999999999999999999999999998754 6677765
>d1o0xa_ d.127.1.1 (A:) Methionine aminopeptidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pv9a2 d.127.1.1 (A:125-345) Aminopeptidase P, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gg2a1 d.127.1.1 (A:3-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chma2 d.127.1.1 (A:157-402) Creatinase, catalytic (C-terminal) domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2v3za2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b6aa2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xgsa2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pv9a2 d.127.1.1 (A:125-345) Aminopeptidase P, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xgsa2 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1chma2 d.127.1.1 (A:157-402) Creatinase, catalytic (C-terminal) domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2gg2a1 d.127.1.1 (A:3-264) Methionine aminopeptidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qxya_ d.127.1.1 (A:) Methionine aminopeptidase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1o0xa_ d.127.1.1 (A:) Methionine aminopeptidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2v3za2 d.127.1.1 (A:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b6aa2 d.127.1.1 (A:110-374,A:449-478) Methionine aminopeptidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure