Citrus Sinensis ID: 026974


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MIREMIITNTNHQVEDNKSNMVLLSQFYPSDVLTPTGIVPQQGEPSKPKRRQRKRNTNGNGGFRALKKRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIEETYATLKTAHENVVVEKTRLESEVATLKEKLSVAEKEIKKMSELIEGISLNNPSATIPTDMDTVDSPFTLDPFAGNLGWFDYEDLLYLLQQNYISAAEWLLLHTY
cHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
********************MVLLSQFYPSDVLT***************************************EQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRA*****KIEETYATLKTAHENVVVEKT***********************************************SPFTLDPFAGNLGWFDYEDLLYLLQQNYISAAEWLLLHTY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIREMIITNTNHQVEDNKSNMVLLSQFYPSDVLTPTGIVPQQGEPSKPKRRQRKRNTNGNGGFRALKKRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIEETYATLKTAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIEGISLNNPSATIPTDMDTVDSPFTLDPFAGNLGWFDYEDLLYLLQQNYISAAEWLLLHTY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox-leucine zipper protein ATHB-40 Probable transcription factor.probableO23208

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L7Z, chain A
Confidence level:very confident
Coverage over the Query: 62-123
View the alignment between query and template
View the model in PyMOL
Template: 2XSD, chain C
Confidence level:confident
Coverage over the Query: 17-37,71-124
View the alignment between query and template
View the model in PyMOL