Citrus Sinensis ID: 026974


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MIREMIITNTNHQVEDNKSNMVLLSQFYPSDVLTPTGIVPQQGEPSKPKRRQRKRNTNGNGGFRALKKRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIEETYATLKTAHENVVVEKTRLESEVATLKEKLSVAEKEIKKMSELIEGISLNNPSATIPTDMDTVDSPFTLDPFAGNLGWFDYEDLLYLLQQNYISAAEWLLLHTY
cHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccHHHHHccccccccHHHHHHHHHHcccccccccHccccccccccccccccccccccccccccHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcc
MIREMIITntnhqvednksnmvllsqfypsdvltptgivpqqgepskpkrrqrkrntngnggfrALKKRKLTAEQAELLEMHfgnehklesDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIEETYATLKTAHENVVVEKTRLESEVATLKEKLSVAEKEIKKMSELIEGislnnpsatiptdmdtvdspftldpfagnlgwfdYEDLLYLLQQNYISAAEWLLLHTY
miremiitntnhqvednksNMVLLSQFYPSDVLtptgivpqqgepskpkrrqrkrntngnggfralkKRKLTAEQAELLEMhfgnehklesDRKDKLAAelgldprqvavwfqnrrardktkKIEETYAtlktahenvvvektrlesevatlkeklsvAEKEIKKMSELIEGISLNNPSATIPTDMDTVDSPFTLDPFAGNLGWFDYEDLLYLLQQNYISAAEWLLLHTY
MIREMIITNTNHQVEDNKSNMVLLSQFYPSDVLTPTGIVPQQGEPSKPKRRQRKRNTNGNGGFRALKKRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIEETYATLKTAHENVVVEKTRLESEVATLKEKLSVAEKEIKKMSELIEGISLNNPSATIPTDMDTVDSPFTLDPFAGNLGWFDYEDLLYLLQQNYISAAEWLLLHTY
********************MVLLSQFYPSDVLT******************************************************************LGLDPRQVAVWFQNRRA*****KIEETYATLKTAHENVVVEKT*******************************************DTVDSPFTLDPFAGNLGWFDYEDLLYLLQQNYISAAEWLLLH**
*************************************************************************EQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRR******************************************************************************************YEDLLYLLQQNYISAAEWLLLHTY
MIREMIITNTNHQVEDNKSNMVLLSQFYPSDVLTPTGIVPQ**************NTNGNGGFRALKKRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIEETYATLKTAHENVVVEKTRLESEVATLKEKLSVAEKEIKKMSELIEGISLNNPSATIPTDMDTVDSPFTLDPFAGNLGWFDYEDLLYLLQQNYISAAEWLLLHTY
MIREMIITNT*HQVEDNKSNMVLLSQFYPSDVLTPTGI***************************LKKRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIEETYATLKTAHENVVVEKTRLESEVATLKEKLSVAEKEIKKMSELI********************SPFTLDPFAGNLGWFDYEDLLYLLQQNYISAAEWLLLHTY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIREMIITNTNHQVEDNKSNMVLLSQFYPSDVLTPTGIVPQQGEPSKPKRRQRKRNTNGNGGFRALKKRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIEETYATLKTAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIEGISLNNPSATIPTDMDTVDSPFTLDPFAGNLGWFDYEDLLYLLQQNYISAAEWLLLHTY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query230 2.2.26 [Sep-21-2011]
O23208216 Homeobox-leucine zipper p yes no 0.913 0.972 0.504 2e-48
Q9ZU70220 Homeobox-leucine zipper p no no 0.886 0.927 0.475 2e-45
Q9LVR0228 Homeobox-leucine zipper p no no 0.678 0.684 0.5 7e-36
Q7XI85240 Homeobox-leucine zipper p yes no 0.434 0.416 0.57 3e-26
A2YN17244 Homeobox-leucine zipper p N/A no 0.434 0.409 0.57 3e-26
Q10QF2239 Homeobox-leucine zipper p no no 0.465 0.447 0.551 5e-25
A2XDK5239 Homeobox-leucine zipper p N/A no 0.465 0.447 0.551 5e-25
Q02283272 Homeobox-leucine zipper p no no 0.547 0.463 0.414 4e-20
Q6YWR4343 Homeobox-leucine zipper p no no 0.504 0.338 0.440 1e-18
A2X980345 Homeobox-leucine zipper p N/A no 0.504 0.336 0.440 1e-18
>sp|O23208|ATB40_ARATH Homeobox-leucine zipper protein ATHB-40 OS=Arabidopsis thaliana GN=ATHB-40 PE=2 SV=3 Back     alignment and function desciption
 Score =  192 bits (487), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 150/222 (67%), Gaps = 12/222 (5%)

Query: 11  NHQVEDNKSNMVLLSQFYPSDVLTPTGIVPQQGEPSKPKRRQRKRN---TNGNGGFRALK 67
           N+ V+D   NM  +SQ YP DV T    + Q GE  +PKRR++K      + +GG    +
Sbjct: 2   NYTVDD--QNMAFISQLYP-DVYTQ---IVQPGEVKQPKRRRKKTKGSVASADGGNGLFR 55

Query: 68  KRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIEET 127
           KRKLT EQ  +LEM FG+EHKLES+RKD+LAAELGLDPRQVAVWFQNRRAR K K++EE 
Sbjct: 56  KRKLTDEQVNMLEMSFGDEHKLESERKDRLAAELGLDPRQVAVWFQNRRARWKNKRLEEE 115

Query: 128 YATLKTAHENVVVEKTRLESEVATLKEKLSVAEKEIKKMSELIEGISLNNPSATIPTDMD 187
           Y  LK +H+NVVV+K RLESEV  LKE+L  AE+EI++++E +EG   +N   +    ++
Sbjct: 116 YNKLKNSHDNVVVDKCRLESEVIQLKEQLYDAEREIQRLAERVEG-GSSNSPISSSVSVE 174

Query: 188 TVDSPFTLDPFAGNLGWFDYEDLLYLLQQN-YISAAEWLLLH 228
             ++PF  D   G+ G  DY+ L Y + +N YI  AEW+ L+
Sbjct: 175 ANETPFFGDYKVGDDG-DDYDHLFYPVPENSYIDEAEWMSLY 215




Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZU70|ATB21_ARATH Homeobox-leucine zipper protein ATHB-21 OS=Arabidopsis thaliana GN=ATHB-21 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVR0|ATB53_ARATH Homeobox-leucine zipper protein ATHB-53 OS=Arabidopsis thaliana GN=ATHB-53 PE=2 SV=1 Back     alignment and function description
>sp|Q7XI85|HOX14_ORYSJ Homeobox-leucine zipper protein HOX14 OS=Oryza sativa subsp. japonica GN=HOX14 PE=2 SV=1 Back     alignment and function description
>sp|A2YN17|HOX14_ORYSI Homeobox-leucine zipper protein HOX14 OS=Oryza sativa subsp. indica GN=HOX14 PE=2 SV=1 Back     alignment and function description
>sp|Q10QF2|HOX12_ORYSJ Homeobox-leucine zipper protein HOX12 OS=Oryza sativa subsp. japonica GN=HOX12 PE=2 SV=1 Back     alignment and function description
>sp|A2XDK5|HOX12_ORYSI Homeobox-leucine zipper protein HOX12 OS=Oryza sativa subsp. indica GN=HOX12 PE=2 SV=1 Back     alignment and function description
>sp|Q02283|HAT5_ARATH Homeobox-leucine zipper protein HAT5 OS=Arabidopsis thaliana GN=HAT5 PE=1 SV=1 Back     alignment and function description
>sp|Q6YWR4|HOX16_ORYSJ Homeobox-leucine zipper protein HOX16 OS=Oryza sativa subsp. japonica GN=HOX16 PE=2 SV=1 Back     alignment and function description
>sp|A2X980|HOX16_ORYSI Homeobox-leucine zipper protein HOX16 OS=Oryza sativa subsp. indica GN=HOX16 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
297798220217 homeobox-leucine zipper protein ATHB-40 0.917 0.972 0.513 8e-49
4006894217 homeodomain protein [Arabidopsis thalian 0.917 0.972 0.509 1e-46
145354375216 homeobox protein 40 [Arabidopsis thalian 0.913 0.972 0.504 1e-46
224096942204 predicted protein [Populus trichocarpa] 0.869 0.980 0.518 1e-45
224134374204 predicted protein [Populus trichocarpa] 0.860 0.970 0.527 7e-45
255568259209 homeobox protein, putative [Ricinus comm 0.9 0.990 0.506 7e-44
15224190220 homeobox-leucine zipper protein ATHB-21 0.886 0.927 0.475 1e-43
225430830211 PREDICTED: homeobox-leucine zipper prote 0.904 0.985 0.491 3e-43
449451501224 PREDICTED: homeobox-leucine zipper prote 0.886 0.910 0.511 4e-42
356496783214 PREDICTED: homeobox-leucine zipper prote 0.886 0.953 0.511 8e-42
>gi|297798220|ref|XP_002866994.1| homeobox-leucine zipper protein ATHB-40 [Arabidopsis lyrata subsp. lyrata] gi|297312830|gb|EFH43253.1| homeobox-leucine zipper protein ATHB-40 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  199 bits (506), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 153/222 (68%), Gaps = 11/222 (4%)

Query: 11  NHQVEDNKSNMVLLSQFYPSDVLTPTGIVPQQGEPSKPKRRQRKRN---TNGNGGFRALK 67
           NH V+D   NM  +SQ YP DV T   +VPQ GE  +PKRR++K      +G+G     +
Sbjct: 2   NHTVDD--QNMAFISQLYP-DVYTQ--LVPQPGEVKQPKRRRKKSKGALASGDGSNSLFR 56

Query: 68  KRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIEET 127
           KRKLT EQ  +LEM FG+EHKLES+RKD+LAAELGLDPRQVAVWFQNRRAR K K++EE 
Sbjct: 57  KRKLTDEQVNMLEMSFGDEHKLESERKDRLAAELGLDPRQVAVWFQNRRARWKNKRLEEE 116

Query: 128 YATLKTAHENVVVEKTRLESEVATLKEKLSVAEKEIKKMSELIEGISLNNPSATIPTDMD 187
           Y  LK +H+NVVV+K RLESEV  LKE+L  AE+EI++++E +E +  +N   +    ++
Sbjct: 117 YNKLKNSHDNVVVDKCRLESEVIQLKEQLYDAEREIQRLAERVE-VGSSNSPISSSVSVE 175

Query: 188 TVDSPFTLDPFAGNLGWFDYEDLLYLLQQN-YISAAEWLLLH 228
             ++PF  D   G+ G  DY++L Y + +N YI  AEW+ L+
Sbjct: 176 ANEAPFFGDYKVGDDG-DDYDNLFYPVPENSYIDEAEWMNLY 216




Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|4006894|emb|CAB16824.1| homeodomain protein [Arabidopsis thaliana] gi|7270622|emb|CAB80340.1| homeodomain protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145354375|ref|NP_195392.2| homeobox protein 40 [Arabidopsis thaliana] gi|322510138|sp|O23208.3|ATB40_ARATH RecName: Full=Homeobox-leucine zipper protein ATHB-40; AltName: Full=HD-ZIP protein ATHB-40; AltName: Full=Homeodomain transcription factor ATHB-40 gi|332661296|gb|AEE86696.1| homeobox protein 40 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224096942|ref|XP_002310795.1| predicted protein [Populus trichocarpa] gi|222853698|gb|EEE91245.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134374|ref|XP_002327822.1| predicted protein [Populus trichocarpa] gi|222836907|gb|EEE75300.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255568259|ref|XP_002525104.1| homeobox protein, putative [Ricinus communis] gi|223535563|gb|EEF37231.1| homeobox protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15224190|ref|NP_179445.1| homeobox-leucine zipper protein ATHB-21 [Arabidopsis thaliana] gi|75268019|sp|Q9ZU70.1|ATB21_ARATH RecName: Full=Homeobox-leucine zipper protein ATHB-21; AltName: Full=HD-ZIP protein ATHB-21; AltName: Full=Homeodomain transcription factor ATHB-21 gi|4218004|gb|AAD12212.1| putative homeodomain transcription factor [Arabidopsis thaliana] gi|182623781|gb|ACB88824.1| At2g18550 [Arabidopsis thaliana] gi|225898118|dbj|BAH30391.1| hypothetical protein [Arabidopsis thaliana] gi|330251686|gb|AEC06780.1| homeobox-leucine zipper protein ATHB-21 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225430830|ref|XP_002273007.1| PREDICTED: homeobox-leucine zipper protein ATHB-40 [Vitis vinifera] gi|297735199|emb|CBI17561.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449451501|ref|XP_004143500.1| PREDICTED: homeobox-leucine zipper protein ATHB-21-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356496783|ref|XP_003517245.1| PREDICTED: homeobox-leucine zipper protein ATHB-40-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query230
TAIR|locus:2115215216 HB40 "homeobox protein 40" [Ar 0.913 0.972 0.522 2e-49
TAIR|locus:2046263220 HB21 "homeobox protein 21" [Ar 0.886 0.927 0.475 1.3e-43
TAIR|locus:2173669228 HB53 "homeobox 53" [Arabidopsi 0.860 0.868 0.449 6.8e-40
TAIR|locus:2084228272 HB-1 "homeobox 1" [Arabidopsis 0.391 0.330 0.536 1.7e-20
TAIR|locus:2144578235 HB51 "homeobox 51" [Arabidopsi 0.7 0.685 0.391 1.2e-19
TAIR|locus:2041283311 HB6 "homeobox protein 6" [Arab 0.643 0.475 0.378 1.1e-18
TAIR|locus:2202795255 AtHB23 "homeobox protein 23" [ 0.452 0.407 0.504 1.7e-18
TAIR|locus:2140055294 HB16 "homeobox protein 16" [Ar 0.460 0.360 0.429 9.5e-18
TAIR|locus:2168225312 HB5 "homeobox protein 5" [Arab 0.469 0.346 0.456 1.2e-17
TAIR|locus:2205075294 ATHB13 [Arabidopsis thaliana ( 0.456 0.357 0.472 3.2e-17
TAIR|locus:2115215 HB40 "homeobox protein 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 515 (186.3 bits), Expect = 2.0e-49, P = 2.0e-49
 Identities = 116/222 (52%), Positives = 154/222 (69%)

Query:    11 NHQVEDNKSNMVLLSQFYPSDVLTPTGIVPQQGEPSKPKRRQRKRN---TNGNGGFRALK 67
             N+ V+D   NM  +SQ YP DV T   IV Q GE  +PKRR++K      + +GG    +
Sbjct:     2 NYTVDDQ--NMAFISQLYP-DVYTQ--IV-QPGEVKQPKRRRKKTKGSVASADGGNGLFR 55

Query:    68 KRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIEET 127
             KRKLT EQ  +LEM FG+EHKLES+RKD+LAAELGLDPRQVAVWFQNRRAR K K++EE 
Sbjct:    56 KRKLTDEQVNMLEMSFGDEHKLESERKDRLAAELGLDPRQVAVWFQNRRARWKNKRLEEE 115

Query:   128 YATLKTAHENVVVEKTRLESEVATLKEKLSVAEKEIKKMSELIEGISLNNPSATIPTDMD 187
             Y  LK +H+NVVV+K RLESEV  LKE+L  AE+EI++++E +EG S N+P ++    ++
Sbjct:   116 YNKLKNSHDNVVVDKCRLESEVIQLKEQLYDAEREIQRLAERVEGGSSNSPISS-SVSVE 174

Query:   188 TVDSPFTLDPFAGNLGWFDYEDLLYLLQQN-YISAAEWLLLH 228
               ++PF  D   G+ G  DY+ L Y + +N YI  AEW+ L+
Sbjct:   175 ANETPFFGDYKVGDDG-DDYDHLFYPVPENSYIDEAEWMSLY 215




GO:0000976 "transcription regulatory region sequence-specific DNA binding" evidence=IEA
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA;ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0009733 "response to auxin stimulus" evidence=IEP
TAIR|locus:2046263 HB21 "homeobox protein 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173669 HB53 "homeobox 53" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084228 HB-1 "homeobox 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144578 HB51 "homeobox 51" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041283 HB6 "homeobox protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202795 AtHB23 "homeobox protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140055 HB16 "homeobox protein 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168225 HB5 "homeobox protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205075 ATHB13 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O23208ATB40_ARATHNo assigned EC number0.50450.91300.9722yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh2_kg.7__393__AT4G36740.1
annotation not avaliable (217 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
pfam0004657 pfam00046, Homeobox, Homeobox domain 3e-15
smart0038957 smart00389, HOX, Homeodomain 4e-15
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-14
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 1e-06
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
 Score = 67.5 bits (166), Expect = 3e-15
 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 67  KKR-KLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDK 120
           +KR   T EQ E LE  F       ++ +++LA +LGL  RQV VWFQNRRA+ K
Sbjct: 2   RKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWK 56


Length = 57

>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 230
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.84
KOG0493342 consensus Transcription factor Engrailed, contains 99.8
KOG0489261 consensus Transcription factor zerknullt and relat 99.73
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.72
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.72
KOG0488309 consensus Transcription factor BarH and related HO 99.72
KOG0843197 consensus Transcription factor EMX1 and related HO 99.68
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.68
KOG0850245 consensus Transcription factor DLX and related pro 99.66
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.65
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.65
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.63
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.61
KOG0848317 consensus Transcription factor Caudal, contains HO 99.6
KOG3802398 consensus Transcription factor OCT-1, contains POU 99.57
KOG0494332 consensus Transcription factor CHX10 and related H 99.56
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.5
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.48
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.47
COG5576156 Homeodomain-containing transcription factor [Trans 99.46
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.45
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.42
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.4
KOG0486351 consensus Transcription factor PTX1, contains HOX 99.34
KOG0847288 consensus Transcription factor, contains HOX domai 99.29
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 99.2
KOG0490235 consensus Transcription factor, contains HOX domai 99.14
KOG0849354 consensus Transcription factor PRD and related pro 98.92
KOG0775304 consensus Transcription factor SIX and related HOX 98.86
KOG0774334 consensus Transcription factor PBX and related HOX 98.74
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.21
KOG2252558 consensus CCAAT displacement protein and related h 98.06
KOG0490235 consensus Transcription factor, contains HOX domai 97.95
KOG1146 1406 consensus Homeobox protein [General function predi 97.42
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.28
KOG0773342 consensus Transcription factor MEIS1 and related H 96.07
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 92.58
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 91.19
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 87.84
KOG4196135 consensus bZIP transcription factor MafK [Transcri 83.67
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
Probab=99.84  E-value=2.4e-21  Score=161.73  Aligned_cols=109  Identities=52%  Similarity=0.705  Sum_probs=101.1

Q ss_pred             cccccccCCCHHHHHHHHHhhccCCCCCHHHHHHHHHHhCCCCcceEEecccchhhhhhhhHHHHHHHHHhhhccchhhh
Q 026974           63 FRALKKRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIEETYATLKTAHENVVVEK  142 (230)
Q Consensus        63 ~~~r~r~~~t~~Q~~~Le~~F~~~~~p~~~~r~~La~~lgL~~~qV~vWFqNRR~k~kr~~~~~~~~~lk~~~~~~~~~~  142 (230)
                      .+..++.+|+.+|+..||..|+...++.+.++..||.+|||.++||+|||||||||||.++++.+++.|+..++.+..++
T Consensus        49 ~~~~kk~Rlt~eQ~~~LE~~F~~~~~L~p~~K~~LAk~LgL~pRQVavWFQNRRARwK~kqlE~d~~~Lk~~~~~l~~~~  128 (198)
T KOG0483|consen   49 KGKGKKRRLTSEQVKFLEKSFESEKKLEPERKKKLAKELGLQPRQVAVWFQNRRARWKTKQLEKDYESLKRQLESLRSEN  128 (198)
T ss_pred             ccccccccccHHHHHHhHHhhccccccChHHHHHHHHhhCCChhHHHHHHhhccccccchhhhhhHHHHHHHHHHHhhhh
Confidence            35567778999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHHHHHHHHHHHHHHHHHhhhhc
Q 026974          143 TRLESEVATLKEKLSVAEKEIKKMSELIE  171 (230)
Q Consensus       143 ~~~~~e~~~l~~~~~~~~~e~~~~~~~~~  171 (230)
                      +.++.++..|..++..+...++.......
T Consensus       129 ~~Lq~e~~eL~~~~~~~~~~~~~~~~~~~  157 (198)
T KOG0483|consen  129 DRLQSEVQELVAELSSLKREMQKSPENTL  157 (198)
T ss_pred             hHHHHHHHHHHHHHhhhhhhhccCccccc
Confidence            99999999999999999988887544433



>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 9e-05
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 1e-04
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 1e-04
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 2e-04
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 3e-04
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 3e-04
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 4e-04
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 4e-04
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 4e-04
2ld5_A67 Solution Nmr-Derived Complex Structure Of Hoxa13 Dn 5e-04
2l7z_A73 Nmr Structure Of A13 Homedomain Length = 73 7e-04
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 8e-04
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure

Iteration: 1

Score = 43.5 bits (101), Expect = 9e-05, Method: Compositional matrix adjust. Identities = 23/62 (37%), Positives = 31/62 (50%) Query: 59 GNGGFRALKKRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRAR 118 G G R ++ T Q LE F H L R+ ++A L L RQ+ +WFQNRR + Sbjct: 15 GTNGLRRRGRQTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALSLTERQIKIWFQNRRMK 74 Query: 119 DK 120 K Sbjct: 75 LK 76
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 Back     alignment and structure
>pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query230
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 2e-20
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 6e-14
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-13
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-13
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-13
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-13
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 4e-13
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 5e-13
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-12
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 3e-12
1e3o_C160 Octamer-binding transcription factor 1; transcript 5e-12
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 5e-12
2xsd_C164 POU domain, class 3, transcription factor 1; trans 1e-11
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 4e-11
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 7e-11
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 9e-11
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-10
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 4e-10
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 1e-09
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-09
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 3e-09
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 9e-09
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 2e-08
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-08
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-08
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-08
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 2e-08
1uhs_A72 HOP, homeodomain only protein; structural genomics 2e-08
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 5e-08
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 7e-08
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 9e-08
3a01_A93 Homeodomain-containing protein; homeodomain, prote 1e-07
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 2e-07
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-07
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 3e-07
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 3e-07
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 3e-07
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 3e-07
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 7e-07
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 1e-06
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 1e-06
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-06
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-06
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 3e-06
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 3e-06
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 3e-06
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 4e-06
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 5e-06
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 8e-06
3a02_A60 Homeobox protein aristaless; homeodomain, developm 9e-06
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 1e-05
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 2e-05
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 4e-05
2e19_A64 Transcription factor 8; homeobox domain, structura 4e-05
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 5e-05
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 5e-05
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 3e-04
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 3e-04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 4e-04
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 9e-04
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
 Score = 80.7 bits (200), Expect = 2e-20
 Identities = 19/54 (35%), Positives = 29/54 (53%)

Query: 67  KKRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDK 120
            K  ++ +    LE  F  +  L S  K+++A + G+ P QV VWF N+R R K
Sbjct: 8   GKSSISPQARAFLEEVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK 61


>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Length = 421 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.78
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.78
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.77
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.77
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.77
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.77
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.77
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.76
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.76
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.76
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.76
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.76
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.75
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.75
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.75
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.75
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.75
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.75
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.75
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.74
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.74
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.74
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.74
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.74
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.74
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.74
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.74
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.74
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.73
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.73
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.73
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.73
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.73
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.73
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.73
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.72
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.72
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.72
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.72
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.72
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.72
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.71
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.71
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.71
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.71
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.7
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.7
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.69
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.69
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.69
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.69
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.68
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.68
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.68
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.68
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.68
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.68
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.66
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.66
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.66
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.65
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.65
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.65
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.64
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.64
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.64
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.64
2e19_A64 Transcription factor 8; homeobox domain, structura 99.63
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.62
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.61
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.59
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.58
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.4
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.39
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.37
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.29
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.24
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.77
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 94.07
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.78  E-value=1e-19  Score=130.73  Aligned_cols=65  Identities=31%  Similarity=0.478  Sum_probs=59.9

Q ss_pred             CCcccccccCCCHHHHHHHHHhhccCCCCCHHHHHHHHHHhCCCCcceEEecccchhhhhhhhHH
Q 026974           61 GGFRALKKRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKTKKIE  125 (230)
Q Consensus        61 ~~~~~r~r~~~t~~Q~~~Le~~F~~~~~p~~~~r~~La~~lgL~~~qV~vWFqNRR~k~kr~~~~  125 (230)
                      ++.+++.|+.|+..|+.+||..|..++||+..++..||..|||++.||++||||||+|+|+....
T Consensus         4 ~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNRR~k~kk~~~~   68 (80)
T 2cue_A            4 GSSGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEKL   68 (80)
T ss_dssp             CCSSCCCCCCSCHHHHHHHHHHHTTCSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCccCHHHHHHHHHHHhccCCCCHHHHHHHHHHhCCCHHHhhHHHHHHHHHHHHHhhh
Confidence            45567788899999999999999999999999999999999999999999999999999987543



>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 230
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 8e-14
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 8e-14
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-13
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-13
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 3e-13
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 3e-13
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 3e-13
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 4e-13
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 5e-13
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 7e-13
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 1e-12
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-12
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 3e-12
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 4e-12
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 4e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 6e-12
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 8e-12
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 9e-12
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-11
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-11
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 3e-11
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 5e-11
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 6e-11
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 8e-11
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 8e-11
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-10
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 2e-10
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 8e-10
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-09
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 1e-08
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 5e-08
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 3e-07
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Lag1 longevity assurance homolog 6, LASS6
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 61.7 bits (150), Expect = 8e-14
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 72  TAEQAELLEMHFG-NEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDK 120
           TA+   +LE  F       +  R + L+ +L  D R +  WF+ RR ++K
Sbjct: 1   TAQPNAILEKVFTAITKHPDEKRLEGLSKQLDWDVRSIQRWFRQRRNQEK 50


>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query230
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.83
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.81
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.81
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.8
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.8
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.8
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.8
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.8
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.79
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.79
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.78
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.78
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.78
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.77
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.76
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.75
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.74
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.74
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.74
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.73
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.72
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.71
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.67
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.67
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.65
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.64
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.63
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.6
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.6
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.57
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.52
d1hlva166 DNA-binding domain of centromere binding protein B 82.2
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.83  E-value=2.3e-22  Score=134.41  Aligned_cols=58  Identities=29%  Similarity=0.539  Sum_probs=55.5

Q ss_pred             ccccccCCCHHHHHHHHHhhccCCCCCHHHHHHHHHHhCCCCcceEEecccchhhhhh
Q 026974           64 RALKKRKLTAEQAELLEMHFGNEHKLESDRKDKLAAELGLDPRQVAVWFQNRRARDKT  121 (230)
Q Consensus        64 ~~r~r~~~t~~Q~~~Le~~F~~~~~p~~~~r~~La~~lgL~~~qV~vWFqNRR~k~kr  121 (230)
                      |+++|+.||.+|+.+||..|..++||+..++++||..|||+++||++||||||+|+||
T Consensus         1 Grr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           1 GRKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            4677889999999999999999999999999999999999999999999999999985



>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure