Citrus Sinensis ID: 026977

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MEMEGKIQKNSRFKRVCVFCGSSTGKRNCYSDAAIDLAHELVARRLDLVYGGGSIGLMGLVSKAVHHGGGNVIGIIPRTLMNKEITGETVGEVRPVADMHQRKAEMARHSDCFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNYLLTFIDKAVDDGFIKPSQRNIIVSAPNAKELVQKLEEYVPVHDGVIAKASWEVDKQQAQQQVGFKATTLQTEVASAL
cccccccccccccccEEEEccccccccHHHHHHHHHHHHHHHHccccEEEccccccHHHHHHHHHHHcccEEEEEccccccHHHccccccccEEEcccHHHHHHHHHHHccCEEEcccccccHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHcccccccccccEEEcccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccHHHHHHHHcc
************FKRVCVFCGSSTGKRNCYSDAAIDLAHELVARRLDLVYGGGSIGLMGLVSKAVHHGGGNVIGIIPRTLMNKEITGETVGEVRPVADMHQRKAEMARHSDCFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNYLLTFIDKAVDDGFIKPSQRNIIVSAPNAKELVQKLEEYVPVHDGVIAKASWE*************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEMEGKIQKNSRFKRVCVFCGSSTGKRNCYSDAAIDLAHELVARRLDLVYGGGSIGLMGLVSKAVHHGGGNVIGIIPRTLMNKEITGETVGEVRPVADMHQRKAEMARHSDCFIALPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYNYLLTFIDKAVDDGFIKPSQRNIIVSAPNAKELVQKLEEYVPVHDGVIAKASWEVDKQQAQQQVGFKATTLQTEVASAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable cytokinin riboside 5'-monophosphate phosphoribohydrolase LOGL10 Cytokinin-activating enzyme working in the direct activation pathway. Phosphoribohydrolase that converts inactive cytokinin nucleotides to the biologically active free-base forms.confidentQ7XDB8
Probable cytokinin riboside 5'-monophosphate phosphoribohydrolase LOGL2 Cytokinin-activating enzyme working in the direct activation pathway. Phosphoribohydrolase that converts inactive cytokinin nucleotides to the biologically active free-base forms.confidentB9F166
Cytokinin riboside 5'-monophosphate phosphoribohydrolase LOG5 Cytokinin-activating enzyme working in the direct activation pathway. Phosphoribohydrolase that converts inactive cytokinin nucleotides to the biologically active free-base forms.confidentQ8LBB7

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.2.-.-Glycosylases.probable
3.2.2.-Hydrolyzing N-glycosyl compounds.probable
3.2.2.n1probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A33, chain A
Confidence level:very confident
Coverage over the Query: 9-190
View the alignment between query and template
View the model in PyMOL