Citrus Sinensis ID: 027005

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MASSSSLSSATPSQLCSSKGGMFCPSRAFLVKPARTQMVTKNPMGMKIKCQATSIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPLSLALAHANVENGKVVFVPWTETDFRTGEAPWWA
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEccccccccccccccccccccccccccccccccEEEECccccccCEEEEcccccccccccccccccEEEcccccccccccccEEccccccccccEEEEEEccEEEEEEccccccccccccccc
*********************MFCPSRAFLVK*AR*********GMKIKCQATSIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPLSLALAHANVENGKVVFVPWTETDFRTGEAPWWA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSSLSSATPSQLCSSKGGMFCPSRAFLVKPARTQMVTKNPMGMKIKCQATSIPADRVPDMGKRQLMNLLLLGAVSLPTGFMLVPYATFFAPPGLGSAGGGTTAKDAIGNDIIAADWLNTHGPGDRTLTEGLKGDPTYLVVEKDKTLASYGINAVCTHLGCVVPWNSAENKFICPCHGSQYNNQGRVVRGPAPLSLALAHANVENGKVVFVPWTETDFRTGEAPWWA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome b6-f complex iron-sulfur subunit, chloroplastic Essential protein for photoautotrophism. Confers resistance to photo-oxidative damages by contributing to the thermal dissipation of light energy and to lumenal acidification (increase of pH gradient). Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.confidentQ9ZR03
Cytochrome b6-f complex iron-sulfur subunit 1, chloroplastic Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.probableP30361
Cytochrome b6-f complex iron-sulfur subunit, chloroplastic Component of the cytochrome b6-f complex, which mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.probableQ69S39

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.10.-.-Acting on diphenols and related substances as donors.probable
1.10.99.-With other acceptors.probable
1.10.99.1Transferred entry: 1.10.9.1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VF5, chain D
Confidence level:very confident
Coverage over the Query: 62-229
View the alignment between query and template
View the model in PyMOL