Citrus Sinensis ID: 027021
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 229 | ||||||
| 449462569 | 313 | PREDICTED: F-box protein SKIP8-like [Cuc | 0.938 | 0.686 | 0.606 | 1e-70 | |
| 225426290 | 307 | PREDICTED: F-box protein SKIP8 [Vitis vi | 0.938 | 0.700 | 0.619 | 4e-68 | |
| 297742355 | 325 | unnamed protein product [Vitis vinifera] | 0.890 | 0.627 | 0.636 | 1e-67 | |
| 356511437 | 286 | PREDICTED: F-box protein SKIP8-like [Gly | 0.886 | 0.709 | 0.610 | 2e-65 | |
| 356523598 | 284 | PREDICTED: F-box protein SKIP8-like [Gly | 0.886 | 0.714 | 0.594 | 2e-63 | |
| 388495556 | 284 | unknown [Medicago truncatula] | 0.868 | 0.700 | 0.582 | 1e-62 | |
| 255537841 | 302 | conserved hypothetical protein [Ricinus | 0.550 | 0.417 | 0.865 | 3e-62 | |
| 388492372 | 284 | unknown [Medicago truncatula] | 0.873 | 0.704 | 0.594 | 3e-62 | |
| 224058184 | 210 | predicted protein [Populus trichocarpa] | 0.554 | 0.604 | 0.866 | 5e-61 | |
| 224072218 | 301 | f-box family protein [Populus trichocarp | 0.572 | 0.435 | 0.832 | 3e-60 |
| >gi|449462569|ref|XP_004149013.1| PREDICTED: F-box protein SKIP8-like [Cucumis sativus] gi|449506211|ref|XP_004162683.1| PREDICTED: F-box protein SKIP8-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 271 bits (693), Expect = 1e-70, Method: Compositional matrix adjust.
Identities = 140/231 (60%), Positives = 161/231 (69%), Gaps = 16/231 (6%)
Query: 1 MEIITST---FFSSQFVIAAIFTIFSLLLAVRTARSTKSTKQSDGATSATSATARKKSCN 57
MEI++S S F IAAI T LLA+ A S + S + ++CN
Sbjct: 1 MEIVSSATIALSSQPFPIAAIVTFLCFLLAIFVAVRLVSVPYIRRTKTLQSESVGTRNCN 60
Query: 58 CTCSCNG--------PAA--ASAAEREMLEVGRHAATA---ATAVVAERGSGASMMEQLV 104
CTCS NG P A S+ M + A A VV ER +GASMMEQLV
Sbjct: 61 CTCSLNGGVVIRGLDPRAEITSSTSTSMPYLNGRAVEVLEKAPVVVTERQTGASMMEQLV 120
Query: 105 PEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKDFTLEQDSVIPVNGWKAY 164
PEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKDFTLEQD+V P+NGWK+Y
Sbjct: 121 PEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKDFTLEQDTVTPINGWKSY 180
Query: 165 YAATRAVVNVNAEFFNIIRERSLPAMSRFWLNADYVKCIHASGELFSGYDS 215
YAATR ++N+NA+F+NIIR+RSL AMSRFWLNADYVKCIHASGE FSGY++
Sbjct: 181 YAATRTIMNINAQFYNIIRDRSLQAMSRFWLNADYVKCIHASGEFFSGYNA 231
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225426290|ref|XP_002265246.1| PREDICTED: F-box protein SKIP8 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297742355|emb|CBI34504.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356511437|ref|XP_003524433.1| PREDICTED: F-box protein SKIP8-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356523598|ref|XP_003530424.1| PREDICTED: F-box protein SKIP8-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|388495556|gb|AFK35844.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|255537841|ref|XP_002509987.1| conserved hypothetical protein [Ricinus communis] gi|223549886|gb|EEF51374.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|388492372|gb|AFK34252.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224058184|ref|XP_002299461.1| predicted protein [Populus trichocarpa] gi|222846719|gb|EEE84266.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224072218|ref|XP_002303658.1| f-box family protein [Populus trichocarpa] gi|222841090|gb|EEE78637.1| f-box family protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 229 | ||||||
| TAIR|locus:505006436 | 231 | AT4G10925 "AT4G10925" [Arabido | 0.519 | 0.515 | 0.848 | 5.5e-54 | |
| TAIR|locus:2138166 | 122 | AT4G23960 "AT4G23960" [Arabido | 0.532 | 1.0 | 0.590 | 4.4e-36 |
| TAIR|locus:505006436 AT4G10925 "AT4G10925" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 558 (201.5 bits), Expect = 5.5e-54, P = 5.5e-54
Identities = 101/119 (84%), Positives = 110/119 (92%)
Query: 96 GASMMEQLVPEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKDFTLEQDSV 155
G SMMEQLVPEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKDFTLEQD +
Sbjct: 33 GVSMMEQLVPEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKDFTLEQDGI 92
Query: 156 IPVNGWKAYYAATRAVVNVNAEFFNIIRERSLPAMSRFWLNADYVKCIHASGELFSGYD 214
PVNGWK YYA TRA+++VN EFF IIR+R+L AM+R WLN+DYVKCIHASGELFSGY+
Sbjct: 93 TPVNGWKEYYATTRAIISVNTEFFTIIRDRALQAMARLWLNSDYVKCIHASGELFSGYN 151
|
|
| TAIR|locus:2138166 AT4G23960 "AT4G23960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00006729001 | SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (307 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 229 | |||
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 5e-06 | |
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 0.003 |
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
Score = 42.1 bits (100), Expect = 5e-06
Identities = 16/45 (35%), Positives = 23/45 (51%)
Query: 100 MEQLVPEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALY 144
+ L EI SYLD L RL++ R+ A+DD+ W+ L
Sbjct: 1 LSDLPDEILLQIFSYLDPRDLLRLALVCRRWRELASDDSLWRRLC 45
|
This is an F-box-like family. Length = 47 |
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 99.55 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 99.11 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 99.01 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 98.6 | |
| KOG3926 | 332 | consensus F-box proteins [Amino acid transport and | 98.28 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.25 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 98.12 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 98.0 | |
| PF06881 | 109 | Elongin_A: RNA polymerase II transcription factor | 97.95 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.81 | |
| TIGR02246 | 128 | conserved hypothetical protein. This family consis | 96.74 | |
| KOG4408 | 386 | consensus Putative Mg2+ and Co2+ transporter CorD | 96.33 | |
| PF13474 | 121 | SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE | 96.19 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 95.3 | |
| PF14534 | 107 | DUF4440: Domain of unknown function (DUF4440); PDB | 92.9 | |
| PF12680 | 102 | SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 | 92.79 | |
| cd00781 | 122 | ketosteroid_isomerase ketosteroid isomerase: Many | 91.37 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 91.26 | |
| COG4319 | 137 | Ketosteroid isomerase homolog [Function unknown] | 90.3 | |
| PF11533 | 125 | DUF3225: Protein of unknown function (DUF3225); In | 85.63 | |
| TIGR02096 | 129 | conserved hypothetical protein, steroid delta-isom | 85.0 | |
| PF09372 | 97 | PRANC: PRANC domain; InterPro: IPR018272 This pres | 84.83 | |
| PRK08241 | 339 | RNA polymerase factor sigma-70; Validated | 83.35 | |
| TIGR02960 | 324 | SigX5 RNA polymerase sigma-70 factor, TIGR02960 fa | 81.59 |
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
Probab=99.55 E-value=3.1e-15 Score=100.52 Aligned_cols=46 Identities=37% Similarity=0.541 Sum_probs=41.1
Q ss_pred hhhccHHHHHHHccCCChHHHHHHhhhcHHHHHHcCCchHHHHHHH
Q 027021 100 MEQLVPEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYH 145 (229)
Q Consensus 100 l~~LP~EILl~ILSyLD~~dL~~lsqvcR~~~~lA~dd~LWr~L~~ 145 (229)
+..||+||+.+||+|||+.||+++++|||+|+++++++.+||++|.
T Consensus 1 i~~LP~Eil~~If~~L~~~dl~~~~~vcr~w~~~~~~~~lW~~~~~ 46 (47)
T PF12937_consen 1 ISSLPDEILLEIFSYLDPRDLLRLSLVCRRWRRIANDNSLWRRLCL 46 (47)
T ss_dssp CCCS-HHHHHHHHTTS-HHHHHHHTTSSHHHHHHHTCCCHHHHHC-
T ss_pred ChHhHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHCChhhhhhhcc
Confidence 4679999999999999999999999999999999999999999875
|
|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3926 consensus F-box proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF06881 Elongin_A: RNA polymerase II transcription factor SIII (Elongin) subunit A; InterPro: IPR010684 This family represents a conserved region within RNA polymerase II transcription factor SIII (Elongin) subunit A | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02246 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG4408 consensus Putative Mg2+ and Co2+ transporter CorD [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A | Back alignment and domain information |
|---|
| >PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A | Back alignment and domain information |
|---|
| >cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >COG4319 Ketosteroid isomerase homolog [Function unknown] | Back alignment and domain information |
|---|
| >PF11533 DUF3225: Protein of unknown function (DUF3225); InterPro: IPR024507 This family of proteins has no known function | Back alignment and domain information |
|---|
| >TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related | Back alignment and domain information |
|---|
| >PF09372 PRANC: PRANC domain; InterPro: IPR018272 This presumed domain is found at the C terminus of a variety of Pox virus proteins | Back alignment and domain information |
|---|
| >PRK08241 RNA polymerase factor sigma-70; Validated | Back alignment and domain information |
|---|
| >TIGR02960 SigX5 RNA polymerase sigma-70 factor, TIGR02960 family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 229 | |||
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 9e-09 | |
| 3gwr_A | 144 | Putative calcium/calmodulin-dependent protein KIN | 2e-08 | |
| 3cnx_A | 170 | Uncharacterized protein; putative dehydratase, NTF | 2e-07 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 2e-05 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 5e-05 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 6e-05 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 9e-05 |
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
Score = 53.6 bits (128), Expect = 9e-09
Identities = 14/52 (26%), Positives = 24/52 (46%)
Query: 97 ASMMEQLVPEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKDF 148
AS + +L ++ + LS+L LC+L TN + D W+ +D
Sbjct: 2 ASTLTRLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDL 53
|
| >3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Length = 144 | Back alignment and structure |
|---|
| >3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 Length = 170 | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Length = 464 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Length = 445 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Length = 435 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 99.54 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 99.47 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.46 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 99.43 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 99.37 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 99.32 | |
| 3gwr_A | 144 | Putative calcium/calmodulin-dependent protein KIN | 99.18 | |
| 3cnx_A | 170 | Uncharacterized protein; putative dehydratase, NTF | 98.97 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.52 | |
| 3b7c_A | 122 | Uncharacterized protein; NTF-2 like protein, struc | 98.2 | |
| 2rcd_A | 129 | Uncharacterized protein; structural genomics, join | 98.2 | |
| 3soy_A | 145 | NTF2-like superfamily protein; structural genomics | 98.02 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.94 | |
| 2owp_A | 129 | Hypothetical protein BXE_B1374; cystatin-like fold | 97.87 | |
| 2ux0_A | 143 | Calcium-calmodulin dependent protein kinase (CAM I | 97.67 | |
| 3f7s_A | 142 | Uncharacterized NTF2-like protein; structural geno | 97.52 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.43 | |
| 3hx8_A | 129 | MLR2180 protein, putative ketosteroid isomerase; s | 97.33 | |
| 3d9r_A | 135 | Ketosteroid isomerase-like protein; YP_049581.1, s | 97.29 | |
| 4hfx_A | 97 | Transcription elongation factor B polypeptide 3; s | 97.28 | |
| 2gxf_A | 142 | Hypothetical protein YYBH; alpha-beta protein., st | 97.17 | |
| 4i4k_A | 143 | Uncharacterized protein SGCJ; structural genomics, | 96.86 | |
| 3bb9_A | 148 | Putative orphan protein; structural genomics, join | 96.84 | |
| 2r4i_A | 123 | Uncharacterized protein; NTF2-like protein, struct | 96.6 | |
| 3rob_A | 139 | Uncharacterized conserved protein; structural geno | 96.55 | |
| 2k54_A | 123 | Protein ATU0742; protein of unknown function, stru | 96.52 | |
| 3h51_A | 156 | Putative calcium/calmodulin dependent protein KIN | 96.49 | |
| 3cu3_A | 172 | Domain of unknown function with A cystatin-like F; | 95.98 | |
| 3fsd_A | 134 | NTF2-like protein of unknown function in nutrient; | 95.17 | |
| 1oh0_A | 131 | Steroid delta-isomerase; ketosteroid isomerase, KS | 94.71 | |
| 1ohp_A | 125 | Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 | 94.54 | |
| 3gzr_A | 146 | Uncharacterized protein with A NTF2-like fold; str | 94.27 | |
| 3f7x_A | 151 | Putative polyketide cyclase; structural genomics, | 93.77 | |
| 2a15_A | 139 | Hypothetical protein RV0760C; beta-alpha-barrel, s | 93.5 | |
| 3g16_A | 156 | Uncharacterized protein with cystatin-like fold; Y | 93.36 | |
| 2bng_A | 149 | MB2760; epoxide hydrolase, limonene, hydrolase, st | 93.29 | |
| 3h3h_A | 122 | Uncharacterized snoal-like protein; structural gen | 93.2 | |
| 3ff2_A | 117 | Uncharacterized cystatin fold protein (YP_497570. | 93.2 | |
| 1nww_A | 149 | Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R | 92.96 | |
| 3dmc_A | 134 | NTF2-like protein; structural genomics, joint cent | 92.56 | |
| 4h3u_A | 158 | Hypothetical protein; structural genomics, PSI-bio | 91.77 | |
| 3f14_A | 112 | Uncharacterized NTF2-like protein; YP_680363.1, NT | 91.69 | |
| 3ebt_A | 132 | Uncharacterized NTF2-like protein; structural geno | 91.28 | |
| 3g8z_A | 148 | Protein of unknown function with cystatin-like FO; | 90.35 | |
| 2chc_A | 170 | Protein RV3472; hypothetical protein; 1.69A {Mycob | 90.1 | |
| 3i0y_A | 140 | Putative polyketide cyclase; cystatin-like fold, s | 89.96 | |
| 1tuh_A | 156 | BAL32A, hypothetical protein EGC068; unknown funct | 89.85 | |
| 3en8_A | 128 | Uncharacterized NTF-2 like protein; YP_553245.1, N | 89.77 | |
| 3fh1_A | 129 | Uncharacterized NTF2-like protein; structural geno | 89.49 | |
| 3fgy_A | 135 | Uncharacterized NTF2-like protein; structural geno | 89.0 | |
| 3dm8_A | 143 | Uncharacterized protein RPA4348; siras, putative i | 88.86 | |
| 3k0z_A | 159 | Putative polyketide cyclase; structural genomics, | 88.24 | |
| 3f40_A | 114 | Uncharacterized NTF2-like protein; YP_677363.1, NT | 87.66 | |
| 2rfr_A | 155 | Uncharacterized protein; structural genomics, join | 87.22 | |
| 3b8l_A | 163 | Uncharacterized protein; putative aromatic ring hy | 86.94 | |
| 1s5a_A | 150 | Hypothetical protein YESE; structural genomics, PS | 86.92 | |
| 3mso_A | 143 | Steroid delta-isomerase; structural genomics, join | 86.89 | |
| 3f8h_A | 150 | Putative polyketide cyclase; structural genomics, | 86.57 | |
| 3hk4_A | 136 | MLR7391 protein; NTF2-like protein, structural gen | 86.24 | |
| 3f8x_A | 148 | Putative delta-5-3-ketosteroid isomerase; structur | 85.28 | |
| 3ec9_A | 140 | Uncharacterized NTF2-like protein; structural geno | 85.08 | |
| 2gex_A | 152 | SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St | 82.41 | |
| 3rga_A | 283 | Epoxide hydrolase; NTF2-like, epoxide-opening cycl | 81.45 | |
| 2f86_B | 143 | Hypothetical protein K11E8.1D; UNC-43, oligomeriza | 80.92 | |
| 1z1s_A | 163 | Hypothetical protein PA3332; beta barrel, conserve | 80.2 | |
| 2f99_A | 153 | Aklanonic acid methyl ester cyclase, AKNH; anthrac | 80.06 |
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
Probab=99.54 E-value=7e-15 Score=130.24 Aligned_cols=112 Identities=19% Similarity=0.226 Sum_probs=84.4
Q ss_pred cCCcCchhhhccHHHHHHHccCCChHHHHHHhhhcHHHHHHcCCchHHHHHHHhhcCccc---------CCCCCCCcchH
Q 027021 93 RGSGASMMEQLVPEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKDFTLEQ---------DSVIPVNGWKA 163 (229)
Q Consensus 93 ~~~~~~~l~~LP~EILl~ILSyLD~~dL~~lsqvcR~~~~lA~dd~LWr~L~~~~f~~~~---------~~~~~~~~WK~ 163 (229)
|....+++..||+|++.+||+|||+.||+++++|||+|+++++|+.+||++|++...... .......+||.
T Consensus 12 ~~~~~d~~~~lp~e~~~~i~~~l~~~~l~~~~~v~~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~wk~ 91 (445)
T 2ovr_B 12 PQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKS 91 (445)
T ss_dssp CCCCCSTTTSSCHHHHHHHHTTSCHHHHHHHTTSCHHHHHHHTCSHHHHHHHTTTTCCSCCCCCC--CCSSCCCCCHHHH
T ss_pred ccccCChhHHCCHHHHHHHHHhCCHHHHHHHHHHhHHHHhhcCchhHhhhheeecccccccccccceecCCCccCCcHHH
Confidence 566789999999999999999999999999999999999999999999999986643211 11123478999
Q ss_pred HHHHHHHHHHhhHHHHHHHHhcChHHHHHhhhcCCce-eEEeCCCcccc
Q 027021 164 YYAATRAVVNVNAEFFNIIRERSLPAMSRFWLNADYV-KCIHASGELFS 211 (229)
Q Consensus 164 lY~~~rAIv~vn~~fY~aIr~gdl~aM~~iW~~~d~V-~CIHPgg~~l~ 211 (229)
.|..+..+. . ..+.+.......+-.+.+.| .|++++|..+.
T Consensus 92 ~~~~~~~~~---~----~w~~~~~~~~~~l~~h~~~v~~~~~~~g~~l~ 133 (445)
T 2ovr_B 92 AYIRQHRID---T----NWRRGELKSPKVLKGHDDHVITCLQFCGNRIV 133 (445)
T ss_dssp HHHHHHHHH---H----HHHHSCCCCCEEEECSTTSCEEEEEEETTEEE
T ss_pred HHhhhhhhh---h----cccCCCcceeEEecccCCCcEEEEEEcCCEEE
Confidence 999877542 2 33556554444445566654 88988776553
|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} | Back alignment and structure |
|---|
| >3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 | Back alignment and structure |
|---|
| >2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 | Back alignment and structure |
|---|
| >3soy_A NTF2-like superfamily protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.00A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 | Back alignment and structure |
|---|
| >2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* | Back alignment and structure |
|---|
| >3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 | Back alignment and structure |
|---|
| >4hfx_A Transcription elongation factor B polypeptide 3; structural genomics, PSI-biology, northeast structural genom consortium, NESG; 2.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 | Back alignment and structure |
|---|
| >4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} | Back alignment and structure |
|---|
| >3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 | Back alignment and structure |
|---|
| >2r4i_A Uncharacterized protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG; HET: MSE CIT; 1.60A {Cytophaga hutchinsonii atcc 33406} SCOP: d.17.4.15 | Back alignment and structure |
|---|
| >3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29 | Back alignment and structure |
|---|
| >3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >3fsd_A NTF2-like protein of unknown function in nutrient; YP_427473.1, NTF2-like protein of unknown function in nutrie uptake; HET: UNL; 1.70A {Rhodospirillum rubrum atcc 11170} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... | Back alignment and structure |
|---|
| >1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A | Back alignment and structure |
|---|
| >3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} | Back alignment and structure |
|---|
| >3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A | Back alignment and structure |
|---|
| >3g16_A Uncharacterized protein with cystatin-like fold; YP_001022489.1, protein of unknown function with cystatin-LI structural genomics; HET: MSE; 1.45A {Methylibium petroleiphilum PM1} | Back alignment and structure |
|---|
| >2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 | Back alignment and structure |
|---|
| >3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} | Back alignment and structure |
|---|
| >3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* | Back alignment and structure |
|---|
| >3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} | Back alignment and structure |
|---|
| >3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 | Back alignment and structure |
|---|
| >3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 | Back alignment and structure |
|---|
| >3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 | Back alignment and structure |
|---|
| >3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 | Back alignment and structure |
|---|
| >3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 | Back alignment and structure |
|---|
| >3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} | Back alignment and structure |
|---|
| >3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 | Back alignment and structure |
|---|
| >1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3f8h_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 2.00A {Silicibacter SP} | Back alignment and structure |
|---|
| >3hk4_A MLR7391 protein; NTF2-like protein, structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, lyase; HET: MSE; 1.96A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 | Back alignment and structure |
|---|
| >3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} | Back alignment and structure |
|---|
| >2f86_B Hypothetical protein K11E8.1D; UNC-43, oligomerization domain, transferase; 2.64A {Caenorhabditis elegans} SCOP: d.17.4.7 | Back alignment and structure |
|---|
| >1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 | Back alignment and structure |
|---|
| >2f99_A Aklanonic acid methyl ester cyclase, AKNH; anthracycline,polyketide cyclase,stereoselectivity, aklavino biosynthetic protein; HET: AKV; 1.90A {Streptomyces galilaeus} SCOP: d.17.4.9 PDB: 2f98_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 229 | ||||
| d1p22a1 | 118 | a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (b | 3e-09 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 5e-09 | |
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 5e-07 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 6e-06 | |
| d3cnxa1 | 153 | d.17.4.17 (A:5-157) Uncharacterized protein SAV467 | 0.002 |
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: F-box/WD-repeat protein 1 (beta-TRCP1) species: Human (Homo sapiens) [TaxId: 9606]
Score = 51.3 bits (122), Expect = 3e-09
Identities = 16/72 (22%), Positives = 25/72 (34%), Gaps = 2/72 (2%)
Query: 101 EQLVPEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKDFTLEQDSVIPVN- 159
+ + I + LSYLD SLC + + +D WK L + +
Sbjct: 16 ARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAER 75
Query: 160 -GWKAYYAATRA 170
GW Y +
Sbjct: 76 RGWGQYLFKNKP 87
|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} Length = 153 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 229 | |||
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 99.78 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 99.62 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 99.6 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d3cnxa1 | 153 | Uncharacterized protein SAV4671 {Streptomyces aver | 99.15 | |
| d2owpa1 | 128 | Hypothetical protein BxeB1374 {Burkholderia xenovo | 98.16 | |
| d3d9ra1 | 132 | Uncharacterized protein ECA1476 {Pectobacterium at | 97.42 | |
| d3b7ca1 | 121 | Uncharacterized protein SO0125 {Shewanella oneiden | 97.42 | |
| d2gxfa1 | 128 | Hypothetical protein YybH {Bacillus subtilis [TaxI | 97.38 | |
| d2ux0a1 | 135 | Association domain of calcium/calmodulin-dependent | 97.34 | |
| d2rcda1 | 127 | Uncharacterized protein ECA3500 {Pectobacterium at | 97.34 | |
| d2f86b1 | 129 | Association domain of calcium/calmodulin-dependent | 96.63 | |
| d3cu3a1 | 162 | Uncharacterized protein NpunR1993 {Nostoc punctifo | 96.3 | |
| d2r4ia1 | 122 | Uncharacterized protein CHU142 {Cytophaga hutchins | 95.63 | |
| d1oh0a_ | 125 | Delta-5-3-ketosteroid isomerase, steroid delta-iso | 95.11 | |
| d2a15a1 | 132 | Hypothetical protein Rv0760c {Mycobacterium tuberc | 94.58 | |
| d3en8a1 | 127 | Uncharacterized protein BxeB2092 {Burkholderia xen | 94.01 | |
| d3bb9a1 | 121 | Uncharacterized protein Sfri1973 {Shewanella frigi | 93.38 | |
| d1ohpa1 | 125 | Delta-5-3-ketosteroid isomerase, steroid delta-iso | 93.29 | |
| d2k54a1 | 123 | Uncharacterized protein Atu0742 {Agrobacterium tum | 93.14 | |
| d2bnga1 | 132 | Uncharacterized protein Mb2760 {Mycobacterium tube | 93.1 | |
| d3ebta1 | 131 | Uncharacterized protein BPSS0132 {Burkholderia pse | 92.75 | |
| d3dm8a1 | 135 | Uncharacterized protein Rpa4348 {Rhodopseudomonas | 90.74 | |
| d1tuha_ | 131 | Hypothetical protein egc068 from a soil-derived mo | 90.31 | |
| d1nwwa_ | 145 | Limonene-1,2-epoxide hydrolase {Rhodococcus erythr | 90.11 | |
| d1z1sa1 | 129 | Uncharacterized protein PA3332 {Pseudomonas aerugi | 89.45 | |
| d1s5aa_ | 139 | Hypothetical protein YesE {Bacillus subtilis [TaxI | 89.08 | |
| d1m98a2 | 142 | Orange carotenoid protein, C-terminal domain {Cyan | 88.52 | |
| d3dmca1 | 133 | Uncharacterized protein Ava2261 {Anabaena variabil | 88.35 | |
| d2gexa1 | 138 | Nogalamycin biosynthesis protein SnoL {Streptomyce | 86.56 | |
| d2f99a1 | 140 | Aklanonic acid methyl ester cyclase, AknH {Strepto | 84.36 |
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: F-box/WD repeat-containing protein 7, FBXW7 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.78 E-value=2.1e-19 Score=133.88 Aligned_cols=82 Identities=21% Similarity=0.263 Sum_probs=69.7
Q ss_pred hcccCCcCchhhhccHHHHHHHccCCChHHHHHHhhhcHHHHHHcCCchHHHHHHHhhcCccc---------CCCCCCCc
Q 027021 90 VAERGSGASMMEQLVPEITTHALSYLDYPSLCRLSMTNSLMRKAANDDNAWKALYHKDFTLEQ---------DSVIPVNG 160 (229)
Q Consensus 90 ~~~~~~~~~~l~~LP~EILl~ILSyLD~~dL~~lsqvcR~~~~lA~dd~LWr~L~~~~f~~~~---------~~~~~~~~ 160 (229)
..+|....|++..||+||+.+||+|||+.||+++++|||+|+++++++.+||++|++++.... .......+
T Consensus 9 ~~~p~~~~D~i~~LP~Eil~~Ils~Ld~~dL~~~~~vcr~w~~l~~~~~lW~~~~~r~~~~~~~~~~~~~~~~~~~~~~~ 88 (102)
T d2ovrb1 9 VIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSP 88 (102)
T ss_dssp HHCCCCCCSTTTSSCHHHHHHHHTTSCHHHHHHHTTSCHHHHHHHTCSHHHHHHHTTTTCCSCCCCCC--CCSSCCCCCH
T ss_pred HcCchhccCChhhCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHcCCCCchHHHhhhcccCCCCCcC
Confidence 446888899999999999999999999999999999999999999999999999998764311 11223567
Q ss_pred chHHHHHHHHH
Q 027021 161 WKAYYAATRAV 171 (229)
Q Consensus 161 WK~lY~~~rAI 171 (229)
||++|++++.+
T Consensus 89 WK~~Y~~~~~l 99 (102)
T d2ovrb1 89 WKSAYIRQHRI 99 (102)
T ss_dssp HHHHHHHHHHH
T ss_pred HHHHHHHHHHH
Confidence 99999988765
|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} | Back information, alignment and structure |
|---|
| >d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} | Back information, alignment and structure |
|---|
| >d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} | Back information, alignment and structure |
|---|
| >d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} | Back information, alignment and structure |
|---|
| >d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} | Back information, alignment and structure |
|---|
| >d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2k54a1 d.17.4.29 (A:1-123) Uncharacterized protein Atu0742 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3ebta1 d.17.4.9 (A:1-131) Uncharacterized protein BPSS0132 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1tuha_ d.17.4.11 (A:) Hypothetical protein egc068 from a soil-derived mobile gene cassette {uncultured organism [TaxId: 155900]} | Back information, alignment and structure |
|---|
| >d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} | Back information, alignment and structure |
|---|
| >d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} | Back information, alignment and structure |
|---|
| >d2f99a1 d.17.4.9 (A:2-141) Aklanonic acid methyl ester cyclase, AknH {Streptomyces galilaeus [TaxId: 33899]} | Back information, alignment and structure |
|---|