Citrus Sinensis ID: 027050

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23

MEKVMNMIKPKPNPQQLLRDWQRKLRQECRNIERQIRDIQREEKNVQKAIKDAAKRNDLSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATMQEFSKEMTKAGVIEEFVNDAVDTALDSEDIEEEIEEEVDKVLTAIAGETAAQLPEAVRKERVKQSAQTSRAAQEEDAVAEGIDDEKELEEIRARLAKVRS

cHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHc

**KV*NMIKPKPN*********************************************LSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATM*********AGVIEEFVNDAVDTA****DI*EEIEEEVDKVLTAIAGE******************************************IRARLAKVR*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEKVMNMIKPKPNPQQLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNDLSSAKSLAQELVRSRKTVNRLYENKAQMNSISMHLGESVAIARTVGHLNKSAEVMKLVNNLMKAPEVAATMQEFSKEMTKAGVIEEFVNDAVDTALDSEDIEEEIEEEVDKVLTAIAGETAAQLPEAVRKERVKQSAQTSRAAQEEDAVAEGIDDEKELEEIRARLAKVRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Vacuolar protein sorting-associated protein 24 homolog 1	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo.	confident	Q9FFB3
Putative vacuolar protein sorting-associated protein 24 homolog 2	Component of the ESCRT-III complex, which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-III complex is probably involved in the concentration of MVB cargo.	probable	Q9LXH5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FRT, chain A
Confidence level:very confident
Coverage over the Query: 14-144
View the alignment between query and template
View the model in PyMOL