Citrus Sinensis ID: 027058


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MAGTAATVNLSSAPYLLRRSSFTTLSSKPSVLPMRPRSKFPRIYAFSSNDIKVGSNIEVDGAPWRVLEFLHVKPGKGAAFVRTKLRNYMSGTTVERTFRAGITVEEADVFKETKQFTYKDGSMFVFMDLTTFEEVRLNETDVGDKKKWLKEGMDCNLLFWKGKIIDFEVPITVQLTVVDVDPGLKGDTASGGSKPATLDTGAVVNVPLFVNIGDEILVDTRTGQYMTRA
cccccEEEEECccccccccccccccccccccccccccccccEEEEEEccccccccEEEEcccEEEEEEEccccccccccEEEEEEcccccccEEEEEEcccccCEEEEEEEEEEEEEEccccEEEEEcccccccECccHHHHccHHHccccccEEEEEEEccEEEEEEcccEEEEEEEEccccccccccccccccEEEccccEEEccccEEcccEEEEEcccccEEccc
*********LSSAPYLLRRSS******************FPRIYAFSSNDIKVGSNIEVDGAPWRVLEFLHVKPGKGAAFVRTKLRNYMSGTTVERTFRAGITVEEADVFKETKQFTYKDGSMFVFMDLTTFEEVRLNETDVGDKKKWLKEGMDCNLLFWKGKIIDFEVPITVQLTVVDVDPGLKGDTASGGSKPATLDTGAVVNVPLFVNIGDEILVDTRTGQYMTRA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGTAATVNLSSAPYLLRRSSFTTLSSKPSVLPMRPRSKFPRIYAFSSNDIKVGSNIEVDGAPWRVLEFLHVKPGKGAAFVRTKLRNYMSGTTVERTFRAGITVEEADVFKETKQFTYKDGSMFVFMDLTTFEEVRLNETDVGDKKKWLKEGMDCNLLFWKGKIIDFEVPITVQLTVVDVDPGLKGDTASGGSKPATLDTGAVVNVPLFVNIGDEILVDTRTGQYMTRA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongation factor P Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.probableQ9K951
Elongation factor P Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.probableQ67N94
Elongation factor P Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA, thus increasing their reactivity as acceptors for peptidyl transferase.probableQ24UX6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YBY, chain A
Confidence level:very confident
Coverage over the Query: 46-229
View the alignment between query and template
View the model in PyMOL