Citrus Sinensis ID: 027067

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MTLRKPPLPRLLLKNVSCMRNAQQILRHVNISIHDGGALVLTGTNGSGKSTFLRMLAGFSKPSAGEILWNGHDITQSGIFHQYKLQLNWLSLKDAVKEKFTVLDNVQWFEVLEGKQGNSLPALELMGLGRLAKEKARMLSMGQRKRLQLARLLAIDRPIWLLDEPSVALDYDGVRLLEYIIAEHRKKGGIVIVATHLPIQIEDAMNLRLPPRFPRRMTLVDMLDRADIS
cccccccccEEEEccEEEEEccEEEEEcccEEECcccEEEEEccccccHHHHHHHHHccccccccEEEEccccccccccHHHHHHccccccccccccccccHHHHHHHHHHHHcccccHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEccccccccccEEEcccccccccccccccccccccc
**********LLLKNVSCMRNAQQILRHVNISIHDGGALVLTGTNGSGKSTFLRMLAGFSKPSAGEILWNGHDITQSGIFHQYKLQLNWLSLKDAVKEKFTVLDNVQWFEVLEGKQGNSLPALELMGLGRLAKEKARMLSMGQRKRLQLARLLAIDRPIWLLDEPSVALDYDGVRLLEYIIAEHRKKGGIVIVATHLPIQIEDAMNLRLPPRFPRRMTLVDM*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLRKPPLPRLLLKNVSCMRNAQQILRHVNISIHDGGALVLTGTNGSGKSTFLRMLAGFSKPSAGEILWNGHDITQSGIFHQYKLQLNWLSLKDAVKEKFTVLDNVQWFEVLEGKQGNSLPALELMGLGRLAKEKARMLSMGQRKRLQLARLLAIDRPIWLLDEPSVALDYDGVRLLEYIIAEHRKKGGIVIVATHLPIQIEDAMNLRLPPRFPRRMTLVDMLDRADIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ABC transporter I family member 1 Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system.confidentQ9C8T1
Cytochrome c biogenesis ATP-binding export protein CcmA Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system.probableP52218
Cytochrome c biogenesis ATP-binding export protein CcmA 2 Part of the ABC transporter complex CcmAB involved in the biogenesis of c-type cytochromes; once thought to export heme, this seems not to be the case, but its exact role is uncertain. Responsible for energy coupling to the transport system.probableQ1LFZ8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.6.-.-Acting on acid anhydrides.probable
3.6.3.-3'-nucleotidase.probable
3.6.3.41Heme-transporting ATPase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 8-206
View the alignment between query and template
View the model in PyMOL