Citrus Sinensis ID: 027072


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MGKSAADDKILSYNDVVLRRSDLDILSGPYFLNDRIIEFYFSYLSSCLVSQDILLVPPSIAFWILNCPDATYLKEFIEPLKLPEKKLVIFPVNDNDDMSLAEGGSHWSLIVYERNGNVFVHHDSNHRMNKIKARKLFSAVVGFMGDSTSASNGKYLDCVDSPQQTNGYDCGVYVIAIARAICCWYESSEHKDAEGMWFSFVKEQVTSTVVSQMRKEILQLIKGLMEKK
cccccccccEEEEccEEEEHHHHccccccccccHHHHHHHHHHHHHccccccEEECccHHHHHHHccccHHHHHHHccccccccccEEEEEECcccccccccccccEEEEEEEccccEEEEECccccccHHHHHHHHHHHHHHHccccccccccEEcccccccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHHHcc
******D**ILSYNDVVLRRSDLDILSGPYFLNDRIIEFYFSYLSSCLVSQDILLVPPSIAFWILNCPDATYLKEFIEPLKLPEKKLVIFPVNDNDDMSLAEGGSHWSLIVYERNGNVFVHHDSNHRMNKIKARKLFSAVVGFMGDSTSASNGKYLDCVDSPQQTNGYDCGVYVIAIARAICCWYESSEHKDAEGMWFSFVKEQVTSTVVSQMRKEILQLIKGLME**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKSAADDKILSYNDVVLRRSDLDILSGPYFLNDRIIEFYFSYLSSCLVSQDILLVPPSIAFWILNCPDATYLKEFIEPLKLPEKKLVIFPVNDNDDMSLAEGGSHWSLIVYERNGNVFVHHDSNHRMNKIKARKLFSAVVGFMGDSTSASNGKYLDCVDSPQQTNGYDCGVYVIAIARAICCWYESSEHKDAEGMWFSFVKEQVTSTVVSQMRKEILQLIKGLMEKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NEDD8-specific protease 1 Processes the pre-form of the ubiquitin-like protein NEDD8/RUB1. Has the capacity to discriminate between NEDD8/RUB1 and ubiquitin. Has no SUMO protease activity.probableQ9LSS7
Sentrin-specific protease 8 Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53.probableQ9D2Z4
Sentrin-specific protease 8 Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53.probableQ5FVJ8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EAY, chain A
Confidence level:very confident
Coverage over the Query: 6-227
View the alignment between query and template
View the model in PyMOL