Citrus Sinensis ID: 027081

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MASAAAAASSAPTIWLTGQGLGGRSTRLPFHWRNKKMEQRKTGGRISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSVSSSLTC
ccHcccccccccccHcccccccccccccccccccccHHHccccccccccCCccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccccccCEECccccccccccccccccccccc
***********P*IW**********TRLP*******************KFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGG**KPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSVSSSLTC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASAAAAASSAPTIWLTGQGLGGRSTRLPFHWRNKKMEQRKTGGRISAKFDLKPPPYPLNALEPHMSKDTLEFHWGKHHRAYVDNLNKQIVGTELGDGKSLEDVVIASYNKGDLLPAFNNAAQAWNHDFFWESMKPGGGGKPSGELLGLIERDFGSFEKFLEEFKAAAATQFGSGWAWLVYKANNRADVANAVNPLPSEKDKSLLVVKTPNAVNPLVWDYSVSSSLTC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Superoxide dismutase [Fe] 2, chloroplastic Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems (By similarity). Plays important role in chloroplast development, particularly in the maintenance of thylakoids membranes. Seems to act as a heterodimer with FSD3.probableQ9LU64
Superoxide dismutase [Fe] Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.probableP37369
Superoxide dismutase [Fe] Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.probableP53641

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.15.-.-Acting on superoxide as acceptor.probable
1.15.1.-Acting on superoxide as acceptor.probable
1.15.1.1Superoxide dismutase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UNF, chain X
Confidence level:very confident
Coverage over the Query: 45-222
View the alignment between query and template
View the model in PyMOL