Citrus Sinensis ID: 027085

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MGNGCFYHVQEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQLAEQRVSEQLSPESPNEENSRPKVEKVGSGEDMKTIDTPKEARKNRKQSFPTWMLLLLVSIFGIVMALPLLQL
ccccccccccccccccEEECcccccEEEEEEEEccccccccccEEEEEEEccccccccccCEEEEccccccccccEEEEEcccccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHcccccccccHHHHHHHHHHHHHHHHcccc
****CFYHVQEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKY*****************************************************FPTWMLLLLVSIFGIVMALPLLQL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNGCFYHVQEPVSHVVARPSPNDILEWHYVLEGSNGTPFAGGYYYGKIKFPPEYPYKPPGILMITPNGRFMTQKKLCLSMSDFHPESWNPMWSVSSILTGLLSFMMDTSPTTGSVNTTTEEKQRLAKASLAFNCKNPAFRKLFPEYVEKYNEQQLAEQRVSEQLSPESPNEENSRPKVEKVGSGEDMKTIDTPKEARKNRKQSFPTWMLLLLVSIFGIVMALPLLQL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2 34 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.confidentQ9SHI7
Ubiquitin-conjugating enzyme E2 6 Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in degradation of misfolded or regulated proteins localized in the endoplasmic reticulum (ER) lumen or membrane via the ubiquitin-proteasome system. Cognate E2 conjugating enzyme for the DOA10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains.probableQ6CMG6
Ubiquitin-conjugating enzyme E2 6 Catalyzes the covalent attachment of ubiquitin to other proteins. Functions in degradation of misfolded or regulated proteins localized in the endoplasmic reticulum (ER) lumen or membrane via the ubiquitin-proteasome system. Cognate E2 conjugating enzyme for the DOA10 ubiquitin ligase complex, which is part of the ERAD-C pathway responsible for the rapid degradation of membrane proteins with misfolded cytoplasmic domains.probableQ6BYG4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F4W, chain A
Confidence level:very confident
Coverage over the Query: 3-78,89-152
View the alignment between query and template
View the model in PyMOL