Citrus Sinensis ID: 027086


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MASQNDDALKRLRCQRIGCNATFTEDDNPEGSCTFHDSGPIFHDGMKEWSCCKRRSHDFSLFLEIPGCKTGKHTTEKPVLTKPVATSKTPAPAPAPSTTLGSSTPSKELCSRCRQGFFCSDHGSQAKEQTNYAPAVPAGSNVAAEVPPVPVKKKIGINEPQICKNKGCGKTFKEKDNHETACSYHPGPAVFHDRMRGWKCCDIHVKEFDEFMGIPPCTKGWHDANLSS
cccccHHcccccEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEECcccccccccCCcccccccccccccccccccccccHHHHccccccccccccccccc
**********RLRCQRIGCNATFTEDDNPEGSCTFHDSGPIFHDGMKEWSCCKRRSHDFSLFLEIPGCKTGK***********************************************************************************GINEPQICKNKGCGKTFKEKDNHETACSYHPGPAVFHDRMRGWKCCDIHVKEFDEFMGIPPCTK*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASQNDDALKRLRCQRIGCNATFTEDDNPEGSCTFHDSGPIFHDGMKEWSCCKRRSHDFSLFLEIPGCKTGKHTTEKPVLTKPVATSKTPAPAPAPSTTLGSSTPSKELCSRCRQGFFCSDHGSQAKEQTNYAPAVPAGSNVAAEVPPVPVKKKIGINEPQICKNKGCGKTFKEKDNHETACSYHPGPAVFHDRMRGWKCCDIHVKEFDEFMGIPPCTKGWHDANLSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cysteine and histidine-rich domain-containing protein RAR1 Required specifically for plant innate immunity. Is essential for resistance conferred by multiple R genes recognizing different bacterial and oomycete pathogen isolates like avirulent P.syringae or H.parasitica (downy mildew). Contributes additively with SGT1B to RPP5-dependent resistance. Functions as positive regulator of RPS5 accumulation by assisting its stabilization. May function as co-chaperone of HSP90-2 to positively regulate the steady-state accumulation of RPM1 and protect it from SGT1-mediated degradation. Acts as negative regulator of pathogen-associated molecular pattern (PAMP)-triggered immunity.probableQ9SE33
Cysteine and histidine-rich domain-containing protein RAR1 Involved in basal disease resistance to virulent strain of bacterial blight (X.oryzae) and compatible race of rice blast fungus (M.grisea). May act as positive regulator of basal defense. Associates with HSP90 and is essential for the pathogen-associated molecular pattern (PAMP)-triggered immune responses specifically enhanced by RAC1.probableQ6EPW7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YRT, chain A
Confidence level:very confident
Coverage over the Query: 9-77
View the alignment between query and template
View the model in PyMOL
Template: 2YRT, chain A
Confidence level:very confident
Coverage over the Query: 161-225
View the alignment between query and template
View the model in PyMOL