Citrus Sinensis ID: 027099


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MAMAVEGGGTLSEIYQSAKKLLLRARDGVEKLERLESSTSTGGYDSPELSFAVKKDISQIQSLCVEMDRLWRSIAAKSQRDLWKRKVEQVAEEAESLKESLDKYFLRNQRRINEARERAELLGRANGESSHILRIFDEEAQAMQSVRNSSRMLQESFATGTAILAKYAEQREHLKKAQRKALDVLNTVGLSNSVLRLIERRNRVDTWIKYVGMVSTVVILYFFWRWTR
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcc
************EIYQSAKKL*LR*************************SFAVKKDISQIQSLCVEMDRLWRSIAAKSQRDLWKR****VAEEAESLKESLDKYFL****************************I*****************LQESFATGTAILAKYAEQREHLKKAQRKALDVLNTVGLSNSVLRLIERRNRVDTWIKYVGMVSTVVILYFFWRWTR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMAVEGGGTLSEIYQSAKKLLLRARDGVEKLERLESSTSTGGYDSPELSFAVKKDISQIQSLCVEMDRLWRSIAAKSQxxxxxxxxxxxxxxxxxxxxxxxxxxxxNQRRINEARERAELLGRANGESSHILRIFDEEAQAMQSVRNSSRMLQESFATGTAILAKYAEQREHLKKAQRKALDVLNTVGLSNSVLRLIERRNRVDTWIKYVGMVSTVVILYFFWRWTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Membrin-11 Involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network.confidentQ9SJL6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NPS, chain C
Confidence level:confident
Coverage over the Query: 148-204
View the alignment between query and template
View the model in PyMOL
Template: 2QYW, chain A
Confidence level:confident
Coverage over the Query: 6-102
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
2k1k, chain Aprobable Alignment | Template Structure