Citrus Sinensis ID: 027102

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MAKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFERYEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRAIITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGSKF
cHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccccHHHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHcccc
cHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHHHHHHHHHcccccHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccccHHHHHHHHHccccHHHHHHHHHHHHcccHHHHccccccHHHHHHHHHHccccc
MAKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFERYEqmhgspidedissvgkgDLVSLMKMVILCIRCPERHFAEVIRTSivgfgtdeAALNRAIITRAEVDMKLIKEVYPimykntleddvigdtsgDYQDFLLTLTGSKF
makealkksksgvkhLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFERYEQMhgspidedissvGKGDLVSLMKMVILCIRCPERHFAEVIRTSivgfgtdeaaLNRAIITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGSKF
MAKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFERYEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRAIITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGSKF
************VKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFERYEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRAIITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTL*****
MAKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFERYEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRAIITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGSKF
*************KHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFERYEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRAIITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGSKF
MAKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFERYEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRAIITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGSKF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFERYEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRAIITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGSKF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query228 2.2.26 [Sep-21-2011]
Q9SE45321 Annexin D3 OS=Arabidopsis yes no 0.942 0.669 0.527 2e-62
P51074314 Annexin-like protein RJ4 N/A no 0.973 0.707 0.431 4e-43
Q94CK4316 Annexin D8 OS=Arabidopsis no no 0.973 0.702 0.391 3e-40
Q9XEE2317 Annexin D2 OS=Arabidopsis no no 0.973 0.700 0.411 1e-39
Q9LX07316 Annexin D7 OS=Arabidopsis no no 0.973 0.702 0.395 2e-38
Q9SYT0317 Annexin D1 OS=Arabidopsis no no 0.960 0.690 0.379 9e-38
Q9LX08318 Annexin D6 OS=Arabidopsis no no 0.969 0.694 0.381 3e-36
Q99JG3317 Annexin A13 OS=Mus muscul yes no 0.973 0.700 0.343 2e-29
P27216316 Annexin A13 OS=Homo sapie yes no 0.903 0.651 0.347 5e-29
Q29471316 Annexin A13 OS=Canis fami yes no 0.903 0.651 0.352 2e-27
>sp|Q9SE45|ANXD3_ARATH Annexin D3 OS=Arabidopsis thaliana GN=ANN3 PE=2 SV=2 Back     alignment and function desciption
 Score =  238 bits (608), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/216 (52%), Positives = 158/216 (73%), Gaps = 1/216 (0%)

Query: 13  VKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYD 72
           +++L+VIVEISC +SP HL AVR+AYC+LFD S+EE I + +  PL K+L+ L S+FRYD
Sbjct: 105 LENLKVIVEISCTTSPNHLIAVRKAYCSLFDSSLEEHIASSLPFPLAKLLVTLASTFRYD 164

Query: 73  KELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFERYEQMHGSPIDED 132
           K+  D E A  EA  L EAI+ KQLDHD V++IL TR+ +QL+ TF  Y++ +G  ID+D
Sbjct: 165 KDRTDAEVATIEAAMLREAIEKKQLDHDHVLYILGTRSIYQLRETFVAYKKNYGVTIDKD 224

Query: 133 ISSV-GKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRAIITRAEVDMKL 191
           +    G  DL SL+K+ I CI  PE+HFA+V+R SI GFGTDE +L RAI+TRAE+D+  
Sbjct: 225 VDGCPGDADLRSLLKVAIFCIDTPEKHFAKVVRDSIEGFGTDEDSLTRAIVTRAEIDLMK 284

Query: 192 IKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGSK 227
           ++  Y  MY  ++++ + GD SGDY+DF++TL GSK
Sbjct: 285 VRGEYFNMYNTSMDNAITGDISGDYKDFIITLLGSK 320

Arabidopsis thaliana (taxid: 3702)
>sp|P51074|ANX4_FRAAN Annexin-like protein RJ4 OS=Fragaria ananassa PE=2 SV=2 Back     alignment and function description
>sp|Q94CK4|ANXD8_ARATH Annexin D8 OS=Arabidopsis thaliana GN=ANNAT8 PE=2 SV=2 Back     alignment and function description
>sp|Q9XEE2|ANXD2_ARATH Annexin D2 OS=Arabidopsis thaliana GN=ANN2 PE=2 SV=1 Back     alignment and function description
>sp|Q9LX07|ANXD7_ARATH Annexin D7 OS=Arabidopsis thaliana GN=ANNAT7 PE=2 SV=1 Back     alignment and function description
>sp|Q9SYT0|ANXD1_ARATH Annexin D1 OS=Arabidopsis thaliana GN=ANN1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LX08|ANXD6_ARATH Annexin D6 OS=Arabidopsis thaliana GN=ANN6 PE=2 SV=1 Back     alignment and function description
>sp|Q99JG3|ANX13_MOUSE Annexin A13 OS=Mus musculus GN=Anxa13 PE=2 SV=3 Back     alignment and function description
>sp|P27216|ANX13_HUMAN Annexin A13 OS=Homo sapiens GN=ANXA13 PE=1 SV=3 Back     alignment and function description
>sp|Q29471|ANX13_CANFA Annexin A13 OS=Canis familiaris GN=ANXA13 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query228
357514971321 Annexin D3 [Medicago truncatula] gi|3555 0.986 0.700 0.608 8e-78
356556843320 PREDICTED: annexin D3-like [Glycine max] 0.982 0.7 0.608 6e-77
255645679320 unknown [Glycine max] 0.982 0.7 0.604 2e-76
255544039319 annexin, putative [Ricinus communis] gi| 1.0 0.714 0.606 1e-75
356548907320 PREDICTED: annexin D3-like [Glycine max] 0.934 0.665 0.621 4e-75
224053304318 predicted protein [Populus trichocarpa] 1.0 0.716 0.587 8e-75
307136392 506 annexin [Cucumis melo subsp. melo] 0.947 0.426 0.588 4e-71
296084414320 unnamed protein product [Vitis vinifera] 1.0 0.712 0.587 4e-71
359495096309 PREDICTED: LOW QUALITY PROTEIN: annexin 0.828 0.611 0.671 2e-70
449449304 499 PREDICTED: LOW QUALITY PROTEIN: annexin 0.960 0.438 0.588 4e-70
>gi|357514971|ref|XP_003627774.1| Annexin D3 [Medicago truncatula] gi|355521796|gb|AET02250.1| Annexin D3 [Medicago truncatula] Back     alignment and taxonomy information
 Score =  295 bits (756), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 137/225 (60%), Positives = 177/225 (78%)

Query: 1   MAKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRK 60
            A++ALK  + G+K LQ++VEI+CASSP HL AVRQAYC+LFDCS+EEDI A VS PL K
Sbjct: 91  FARDALKVKRKGIKQLQILVEIACASSPNHLMAVRQAYCSLFDCSLEEDIIASVSQPLTK 150

Query: 61  VLLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFER 120
           +L+ LVSSFR+DK  +++E A SEA +LHEAI   +LD D  V IL+TRN FQ++ TF  
Sbjct: 151 ILVGLVSSFRHDKVTVNLEVAKSEAEKLHEAINNNKLDDDHFVWILSTRNVFQIRETFAS 210

Query: 121 YEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRA 180
           Y+Q++G   +EDI + GKGDL SL+ +V+ CI CPE+HFA+VIR SIVG GTDE +LNRA
Sbjct: 211 YKQLYGKTFEEDIKTCGKGDLTSLLNVVVWCIECPEKHFAKVIRDSIVGLGTDEDSLNRA 270

Query: 181 IITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTG 225
           I+TRAE+D+  ++  Y  MYK++L+DDVIGDTSGDY +FLLTL G
Sbjct: 271 IVTRAEIDLLKVRFEYANMYKSSLDDDVIGDTSGDYMEFLLTLLG 315

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356556843|ref|XP_003546730.1| PREDICTED: annexin D3-like [Glycine max] Back     alignment and taxonomy information
>gi|255645679|gb|ACU23333.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255544039|ref|XP_002513082.1| annexin, putative [Ricinus communis] gi|223548093|gb|EEF49585.1| annexin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356548907|ref|XP_003542840.1| PREDICTED: annexin D3-like [Glycine max] Back     alignment and taxonomy information
>gi|224053304|ref|XP_002297754.1| predicted protein [Populus trichocarpa] gi|222845012|gb|EEE82559.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|307136392|gb|ADN34202.1| annexin [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|296084414|emb|CBI24802.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495096|ref|XP_002265119.2| PREDICTED: LOW QUALITY PROTEIN: annexin D3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449449304|ref|XP_004142405.1| PREDICTED: LOW QUALITY PROTEIN: annexin D3-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query228
TAIR|locus:2064217321 ANNAT3 "annexin 3" [Arabidopsi 0.969 0.688 0.522 9.3e-59
TAIR|locus:505006606316 ANNAT8 "annexin 8" [Arabidopsi 0.973 0.702 0.391 1.6e-38
TAIR|locus:2177709317 ANNAT2 "annexin 2" [Arabidopsi 0.973 0.700 0.411 1.5e-37
TAIR|locus:2184123316 ANNAT7 "annexin 7" [Arabidopsi 0.973 0.702 0.395 1.7e-36
TAIR|locus:2011344317 ANNAT1 "annexin 1" [Arabidopsi 0.960 0.690 0.379 2.4e-35
TAIR|locus:2184108318 ANN6 "annexin 6" [Arabidopsis 0.969 0.694 0.381 4e-35
MGI|MGI:1917037317 Anxa13 "annexin A13" [Mus musc 0.973 0.700 0.343 3.8e-30
UNIPROTKB|F1NNR3319 ANXA13 "Annexin" [Gallus gallu 0.969 0.692 0.334 3.4e-29
UNIPROTKB|P27216316 ANXA13 "Annexin A13" [Homo sap 0.973 0.702 0.339 3.4e-29
RGD|1307545319 Anxa13 "annexin A13" [Rattus n 0.973 0.695 0.334 9.1e-29
TAIR|locus:2064217 ANNAT3 "annexin 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 603 (217.3 bits), Expect = 9.3e-59, P = 9.3e-59
 Identities = 116/222 (52%), Positives = 161/222 (72%)

Query:     7 KKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLV 66
             +K K  +++L+VIVEISC +SP HL AVR+AYC+LFD S+EE I + +  PL K+L+ L 
Sbjct:    99 EKKKKSLENLKVIVEISCTTSPNHLIAVRKAYCSLFDSSLEEHIASSLPFPLAKLLVTLA 158

Query:    67 SSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFERYEQMHG 126
             S+FRYDK+  D E A  EA  L EAI+ KQLDHD V++IL TR+ +QL+ TF  Y++ +G
Sbjct:   159 STFRYDKDRTDAEVATIEAAMLREAIEKKQLDHDHVLYILGTRSIYQLRETFVAYKKNYG 218

Query:   127 SPIDEDISSV-GKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRAIITRA 185
               ID+D+    G  DL SL+K+ I CI  PE+HFA+V+R SI GFGTDE +L RAI+TRA
Sbjct:   219 VTIDKDVDGCPGDADLRSLLKVAIFCIDTPEKHFAKVVRDSIEGFGTDEDSLTRAIVTRA 278

Query:   186 EVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGSK 227
             E+D+  ++  Y  MY  ++++ + GD SGDY+DF++TL GSK
Sbjct:   279 EIDLMKVRGEYFNMYNTSMDNAITGDISGDYKDFIITLLGSK 320
GO:0005509 "calcium ion binding" evidence=IEA;ISS;NAS
GO:0005544 "calcium-dependent phospholipid binding" evidence=IEA;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0009986 "cell surface" evidence=NAS
GO:0005773 "vacuole" evidence=IDA
GO:0009408 "response to heat" evidence=IEP
GO:0009409 "response to cold" evidence=IEP
GO:0009414 "response to water deprivation" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
TAIR|locus:505006606 ANNAT8 "annexin 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177709 ANNAT2 "annexin 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184123 ANNAT7 "annexin 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2011344 ANNAT1 "annexin 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184108 ANN6 "annexin 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1917037 Anxa13 "annexin A13" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNR3 ANXA13 "Annexin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P27216 ANXA13 "Annexin A13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1307545 Anxa13 "annexin A13" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SE45ANXD3_ARATHNo assigned EC number0.52770.94290.6697yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
pfam0019166 pfam00191, Annexin, Annexin 2e-18
smart0033553 smart00335, ANX, Annexin repeats 3e-15
pfam0019166 pfam00191, Annexin, Annexin 7e-12
smart0033553 smart00335, ANX, Annexin repeats 3e-06
pfam0019166 pfam00191, Annexin, Annexin 1e-04
smart0033553 smart00335, ANX, Annexin repeats 0.001
>gnl|CDD|201070 pfam00191, Annexin, Annexin Back     alignment and domain information 
 Score = 75.6 bits (187), Expect = 2e-18
 Identities = 26/66 (39%), Positives = 41/66 (62%)

Query: 158 HFAEVIRTSIVGFGTDEAALNRAIITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQ 217
           + AE++R ++ G GTDE  L R + TR+   ++ I+E Y  +Y   LE D+  +TSGD++
Sbjct: 1   YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKLYGKDLEKDIKSETSGDFE 60

Query: 218 DFLLTL 223
             LL L
Sbjct: 61  KLLLAL 66

This family of annexins also includes giardin that has been shown to function as an annexin. Length = 66
>gnl|CDD|197661 smart00335, ANX, Annexin repeats Back     alignment and domain information
>gnl|CDD|201070 pfam00191, Annexin, Annexin Back     alignment and domain information
>gnl|CDD|197661 smart00335, ANX, Annexin repeats Back     alignment and domain information
>gnl|CDD|201070 pfam00191, Annexin, Annexin Back     alignment and domain information
>gnl|CDD|197661 smart00335, ANX, Annexin repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 228
KOG0819321 consensus Annexin [Intracellular trafficking, secr 100.0
KOG0819321 consensus Annexin [Intracellular trafficking, secr 100.0
PF0019166 Annexin: Annexin; InterPro: IPR018502 The annexins 99.79
PF0019166 Annexin: Annexin; InterPro: IPR018502 The annexins 99.72
smart0033553 ANX Annexin repeats. 99.6
smart0033553 ANX Annexin repeats. 99.57
>KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-65  Score=424.90  Aligned_cols=223  Identities=37%  Similarity=0.558  Sum_probs=218.8

Q ss_pred             HHHHhcCCCCCCCCHHHHHHHHhcCCHHHHHHHHHHHHhhhcccHHHHHHhccCchHHHHHHHHhhhccCCchhhCHHHH
Q 027102            2 AKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYDKELLDIEAA   81 (228)
Q Consensus         2 l~~A~kg~~~~gtde~~li~il~~rs~~~~~~i~~~Y~~~~~~~L~~di~~~~sg~~~~ll~~ll~~~r~e~~~i~~~~~   81 (228)
                      |++||||   +||||++||||+|+|||.|+++|+++|+..|+++|++||.+++||+|+++|+.++++.|+|...||+..+
T Consensus        97 l~~amkg---~gtde~vlIEIlcTRT~~el~~i~~aY~~~y~~sLEeDI~s~TSG~frklLv~L~~~~R~e~~~vd~~la  173 (321)
T KOG0819|consen   97 LKKAMKG---LGTDEKVLIEILCTRTNEELRAIRQAYQELYKKSLEEDIASDTSGDFRKLLVSLVQGNRDEGDRVDDALA  173 (321)
T ss_pred             HHHHHhc---cCcchhhheeeeccCCHHHHHHHHHHHHHHHcccHHHHhhhccCchHHHHHHHHHhcCCccCCCcCHHHH
Confidence            7899999   9999999999999999999999999999999999999999999999999999999999999889999999


Q ss_pred             HHHHHHHHHhhhcCCC-CHHHHHHHhhcCCHHHHHHHHHHHHHhhCCChHHhhhhcccCcHHHHHHHHHHHhcChhhhHH
Q 027102           82 ASEANQLHEAIKAKQL-DHDQVVHILATRNFFQLKATFERYEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFA  160 (228)
Q Consensus        82 ~~da~~L~~a~~g~~~-d~~~li~il~~rs~~~l~~i~~~Y~~~~g~~L~~~i~~~~~g~~~~~l~~lv~~~~~~~~~~A  160 (228)
                      ++||+.|++|++++++ |+..++.||++||..|++.++++|+..+|+++++.|+++++|+|+.+|++++.|++|||.|||
T Consensus       174 ~~dA~~L~~Age~k~gtde~~~~~Il~tRs~~qL~~vf~~y~~~~g~diek~I~~e~~gd~~~~llaiv~c~~n~~~yFA  253 (321)
T KOG0819|consen  174 KQDAQDLYEAGEKKWGTDEDKFIRILTTRSKAQLRLVFEEYQRISGKDIEKSIKEEFSGDFEKLLLAIVKCIRNPPAYFA  253 (321)
T ss_pred             HHHHHHHHHHhhhhccCcHHHHHHHHHhCCHHHHHHHHHHHHHhcchhHHHHHhhccCchHHHHHHHHHHHHcCHHHHHH
Confidence            9999999999998765 777999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhccCCCchHHHHHHHHhcCHHHHHHHHHHHhhhhCCChHHhhhhcccHHHHHHHHHhhccC
Q 027102          161 EVIRTSIVGFGTDEAALNRAIITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGSK  227 (228)
Q Consensus       161 ~~L~~A~~g~gtd~~~li~il~~rs~~~l~~i~~~Y~~~yg~sL~~~I~~~~sG~~~~~Ll~l~~~~  227 (228)
                      +.||.||+|.|||+++||||+|+|||.||..|+.+|+++||+||.++|+.+|||||+++|++||+++
T Consensus       254 ~~L~~amkg~GTdd~~LiRI~VsRsEiDl~~Ik~ef~~~Y~ksL~~~I~~dtsGdY~~~LlaL~g~~  320 (321)
T KOG0819|consen  254 ERLRKAMKGLGTDDKTLIRIVVSRSEIDLLDIKEEFQRKYGKSLYSAIKGDTSGDYKKALLALLGGD  320 (321)
T ss_pred             HHHHHHHhccCCCccceeeeeeeHHHhhHHHHHHHHHHHhCccHHHHHhhhccchHHHHHHHHhCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999999975

>KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] Back     alignment and domain information
>PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] Back     alignment and domain information
>smart00335 ANX Annexin repeats Back     alignment and domain information
>smart00335 ANX Annexin repeats Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
3brx_A317 Crystal Structure Of Calcium-Bound Cotton Annexin G 7e-40
3brx_A 317 Crystal Structure Of Calcium-Bound Cotton Annexin G 6e-04
1n00_A321 Annexin Gh1 From Cotton Length = 321 9e-40
1n00_A 321 Annexin Gh1 From Cotton Length = 321 7e-04
1ycn_A317 X-Ray Structure Of Annexin From Arabidopsis Thalian 7e-39
1ycn_A 317 X-Ray Structure Of Annexin From Arabidopsis Thalian 1e-05
1dk5_A322 Crystal Structure Of Annexin 24(Ca32) From Capsicum 8e-36
1dk5_A 322 Crystal Structure Of Annexin 24(Ca32) From Capsicum 4e-06
1w3w_A327 The 2.1 Angstroem Resolution Structure Of Annexin A 1e-24
1w45_A327 The 2.5 Angstroem Structure Of The K16a Mutant Of A 1e-24
2zhi_A322 Crystal Structure Analysis Of The Sodium-Bound Anne 3e-24
2zhi_A 322 Crystal Structure Analysis Of The Sodium-Bound Anne 5e-11
2zoc_A319 Crystal Structure Of Recombinant Human Annexin Iv L 2e-23
2zoc_A 319 Crystal Structure Of Recombinant Human Annexin Iv L 7e-10
1i4a_A318 Crystal Structure Of Phosphorylation-Mimicking Muta 4e-23
1i4a_A 318 Crystal Structure Of Phosphorylation-Mimicking Muta 6e-11
1ann_A318 Annexin Iv Length = 318 4e-23
1ann_A 318 Annexin Iv Length = 318 6e-11
1aow_A309 Annexin Iv Length = 309 4e-23
1aow_A 309 Annexin Iv Length = 309 5e-11
2h0k_A318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 8e-23
2h0k_A 318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 1e-13
1avc_A673 Bovine Annexin Vi (Calcium-Bound) Length = 673 9e-23
1avc_A 673 Bovine Annexin Vi (Calcium-Bound) Length = 673 8e-12
1aii_A323 Annexin Iii Length = 323 1e-22
1aii_A 323 Annexin Iii Length = 323 6e-13
2h0l_A318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 1e-22
2h0l_A 318 Crystal Structure Of A Mutant Of Rat Annexin A5 Len 5e-14
1axn_A323 The High Resolution Structure Of Annexin Iii Shows 1e-22
1axn_A 323 The High Resolution Structure Of Annexin Iii Shows 6e-13
1bc3_A319 Recombinant Rat Annexin V, Triple Mutant (T72k, S14 2e-22
1bc3_A 319 Recombinant Rat Annexin V, Triple Mutant (T72k, S14 3e-13
1g5n_A318 Annexin V Complex With Heparin Oligosaccharides Len 2e-22
1g5n_A 318 Annexin V Complex With Heparin Oligosaccharides Len 1e-13
1a8a_A319 Rat Annexin V Complexed With Glycerophosphoserine L 2e-22
1a8a_A 319 Rat Annexin V Complexed With Glycerophosphoserine L 1e-13
2ran_A316 Rat Annexin V Crystal Structure: Ca2+-Induced Confo 2e-22
2ran_A 316 Rat Annexin V Crystal Structure: Ca2+-Induced Confo 1e-13
1n44_A319 Crystal Structure Of Annexin V R23e Mutant Length = 2e-22
1n44_A 319 Crystal Structure Of Annexin V R23e Mutant Length = 1e-13
1n41_A319 Crystal Structure Of Annexin V K27e Mutant Length = 2e-22
1n41_A 319 Crystal Structure Of Annexin V K27e Mutant Length = 4e-13
1bcw_A319 Recombinant Rat Annexin V, T72a Mutant Length = 319 2e-22
1bcw_A 319 Recombinant Rat Annexin V, T72a Mutant Length = 319 1e-13
1bcy_A319 Recombinant Rat Annexin V, T72k Mutant Length = 319 2e-22
1bcy_A 319 Recombinant Rat Annexin V, T72k Mutant Length = 319 9e-14
1bcz_A319 Recombinant Rat Annexin V, T72s Mutant Length = 319 2e-22
1bcz_A 319 Recombinant Rat Annexin V, T72s Mutant Length = 319 2e-13
1bc0_A319 Recombinant Rat Annexin V, W185a Mutant Length = 31 2e-22
1bc0_A 319 Recombinant Rat Annexin V, W185a Mutant Length = 31 1e-13
2h0m_A318 Structure Of A Mutant Of Rat Annexin A5 Length = 31 2e-22
2h0m_A 318 Structure Of A Mutant Of Rat Annexin A5 Length = 31 1e-13
1n42_A319 Crystal Structure Of Annexin V R149e Mutant Length 3e-22
1n42_A 319 Crystal Structure Of Annexin V R149e Mutant Length 5e-14
1yii_A320 Crystal Structures Of Chicken Annexin V In Complex 5e-22
1yii_A 320 Crystal Structures Of Chicken Annexin V In Complex 5e-12
1bc1_A319 Recombinant Rat Annexin V, Quadruple Mutant (T72k, 5e-22
1bc1_A 319 Recombinant Rat Annexin V, Quadruple Mutant (T72k, 3e-13
1m9i_A 672 Crystal Structure Of Phosphorylation-Mimicking Muta 7e-22
1m9i_A 672 Crystal Structure Of Phosphorylation-Mimicking Muta 8e-12
1hve_A319 Structural And Electrophysiological Analysis Of Ann 1e-21
1hve_A 319 Structural And Electrophysiological Analysis Of Ann 1e-12
1hvf_A319 Structural And Electrophysiological Analysis Of Ann 1e-21
1hvf_A 319 Structural And Electrophysiological Analysis Of Ann 1e-12
1anw_A319 The Effect Of Metal Binding On The Structure Of Ann 1e-21
1anw_A 319 The Effect Of Metal Binding On The Structure Of Ann 1e-12
1hvd_A319 Structural And Electrophysiological Analysis Of Ann 1e-21
1hvd_A 319 Structural And Electrophysiological Analysis Of Ann 1e-12
1avh_A320 Crystal And Molecular Structure Of Human Annexin V 1e-21
1avh_A 320 Crystal And Molecular Structure Of Human Annexin V 1e-12
1ala_A321 Structure Of Chicken Annexin V At 2.25-Angstroms Re 2e-21
1ala_A 321 Structure Of Chicken Annexin V At 2.25-Angstroms Re 5e-12
2xo2_A320 Human Annexin V With Incorporated Methionine Analog 3e-21
2xo2_A 320 Human Annexin V With Incorporated Methionine Analog 3e-12
1sav_A320 Human Annexin V With Proline Substitution By Thiopr 2e-20
1sav_A 320 Human Annexin V With Proline Substitution By Thiopr 4e-12
1xjl_A319 Structure Of Human Annexin A2 In The Presence Of Ca 4e-20
1xjl_A 319 Structure Of Human Annexin A2 In The Presence Of Ca 1e-12
2hyu_A308 Human Annexin A2 With Heparin Tetrasaccharide Bound 4e-20
2hyu_A 308 Human Annexin A2 With Heparin Tetrasaccharide Bound 1e-12
1w7b_A339 Annexin A2: Does It Induce Membrane Aggregation By 4e-20
1w7b_A 339 Annexin A2: Does It Induce Membrane Aggregation By 1e-12
1dm5_A315 Annexin Xii E105k Homohexamer Crystal Structure Len 5e-20
1dm5_A 315 Annexin Xii E105k Homohexamer Crystal Structure Len 1e-12
1dm5_A 315 Annexin Xii E105k Homohexamer Crystal Structure Len 4e-05
1aei_A315 Crystal Structure Of The Annexin Xii Hexamer Length 5e-20
1aei_A 315 Crystal Structure Of The Annexin Xii Hexamer Length 3e-13
1aei_A 315 Crystal Structure Of The Annexin Xii Hexamer Length 4e-05
1ain_A314 Crystal Structure Of Human Annexin I At 2.5 Angstro 1e-17
1ain_A 314 Crystal Structure Of Human Annexin I At 2.5 Angstro 7e-14
1hm6_A346 X-Ray Structure Of Full-Length Annexin 1 Length = 3 1e-16
>pdb|3BRX|A Chain A, Crystal Structure Of Calcium-Bound Cotton Annexin Gh1 Length = 317 Back     alignment and structure 
Iteration: 1

 Score =  160 bits (404), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 87/225 (38%), Positives = 133/225 (59%), Gaps = 3/225 (1%)
Query: 1   MAKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRK 60
           +A EA K+  S     QV++EI+C  S   L   RQAY A +  S+EED+    +    K
Sbjct: 92  LANEATKRWTSSN---QVLMEIACTRSANQLLHARQAYHARYKKSLEEDVAHHTTGDFHK 148
Query: 61  VLLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFER 120
           +LL LVSS+RY+ E +++  A +EA  LHE I  K    D V+ +LATR+  Q+ AT   
Sbjct: 149 LLLPLVSSYRYEGEEVNMTLAKTEAKLLHEKISNKAYSDDDVIRVLATRSKAQINATLNH 208
Query: 121 YEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRA 180
           Y+  +G+ I++D+ +  K + ++L++  + C+  PE++F +V+R +I   GTDE AL R 
Sbjct: 209 YKNEYGNDINKDLKADPKDEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGALTRV 268
Query: 181 IITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTG 225
           + TRAEVD+K+I + Y       L   ++ DT GDY+  LL L G
Sbjct: 269 VCTRAEVDLKVIADEYQRRNSVPLTRAIVKDTHGDYEKLLLVLAG 313
>pdb|3BRX|A Chain A, Crystal Structure Of Calcium-Bound Cotton Annexin Gh1 Length = 317 Back     alignment and structure
>pdb|1N00|A Chain A, Annexin Gh1 From Cotton Length = 321 Back     alignment and structure
>pdb|1N00|A Chain A, Annexin Gh1 From Cotton Length = 321 Back     alignment and structure
>pdb|1YCN|A Chain A, X-Ray Structure Of Annexin From Arabidopsis Thaliana Gene At1g35720 Length = 317 Back     alignment and structure
>pdb|1YCN|A Chain A, X-Ray Structure Of Annexin From Arabidopsis Thaliana Gene At1g35720 Length = 317 Back     alignment and structure
>pdb|1DK5|A Chain A, Crystal Structure Of Annexin 24(Ca32) From Capsicum Annuum Length = 322 Back     alignment and structure
>pdb|1DK5|A Chain A, Crystal Structure Of Annexin 24(Ca32) From Capsicum Annuum Length = 322 Back     alignment and structure
>pdb|1W3W|A Chain A, The 2.1 Angstroem Resolution Structure Of Annexin A8 Length = 327 Back     alignment and structure
>pdb|1W45|A Chain A, The 2.5 Angstroem Structure Of The K16a Mutant Of Annexin A8, Which Has An Intact N-Terminus. Length = 327 Back     alignment and structure
>pdb|2ZHI|A Chain A, Crystal Structure Analysis Of The Sodium-Bound Annexin A4 At 1.58 A Resolution Length = 322 Back     alignment and structure
>pdb|2ZHI|A Chain A, Crystal Structure Analysis Of The Sodium-Bound Annexin A4 At 1.58 A Resolution Length = 322 Back     alignment and structure
>pdb|2ZOC|A Chain A, Crystal Structure Of Recombinant Human Annexin Iv Length = 319 Back     alignment and structure
>pdb|2ZOC|A Chain A, Crystal Structure Of Recombinant Human Annexin Iv Length = 319 Back     alignment and structure
>pdb|1I4A|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T6d Of Annexin Iv Length = 318 Back     alignment and structure
>pdb|1I4A|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T6d Of Annexin Iv Length = 318 Back     alignment and structure
>pdb|1ANN|A Chain A, Annexin Iv Length = 318 Back     alignment and structure
>pdb|1ANN|A Chain A, Annexin Iv Length = 318 Back     alignment and structure
>pdb|1AOW|A Chain A, Annexin Iv Length = 309 Back     alignment and structure
>pdb|1AOW|A Chain A, Annexin Iv Length = 309 Back     alignment and structure
>pdb|2H0K|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|2H0K|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|1AVC|A Chain A, Bovine Annexin Vi (Calcium-Bound) Length = 673 Back     alignment and structure
>pdb|1AVC|A Chain A, Bovine Annexin Vi (Calcium-Bound) Length = 673 Back     alignment and structure
>pdb|1AII|A Chain A, Annexin Iii Length = 323 Back     alignment and structure
>pdb|1AII|A Chain A, Annexin Iii Length = 323 Back     alignment and structure
>pdb|2H0L|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|2H0L|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|1AXN|A Chain A, The High Resolution Structure Of Annexin Iii Shows Differences With Annexin V Length = 323 Back     alignment and structure
>pdb|1AXN|A Chain A, The High Resolution Structure Of Annexin Iii Shows Differences With Annexin V Length = 323 Back     alignment and structure
>pdb|1BC3|A Chain A, Recombinant Rat Annexin V, Triple Mutant (T72k, S144k, S228k) Length = 319 Back     alignment and structure
>pdb|1BC3|A Chain A, Recombinant Rat Annexin V, Triple Mutant (T72k, S144k, S228k) Length = 319 Back     alignment and structure
>pdb|1G5N|A Chain A, Annexin V Complex With Heparin Oligosaccharides Length = 318 Back     alignment and structure
>pdb|1G5N|A Chain A, Annexin V Complex With Heparin Oligosaccharides Length = 318 Back     alignment and structure
>pdb|1A8A|A Chain A, Rat Annexin V Complexed With Glycerophosphoserine Length = 319 Back     alignment and structure
>pdb|1A8A|A Chain A, Rat Annexin V Complexed With Glycerophosphoserine Length = 319 Back     alignment and structure
>pdb|2RAN|A Chain A, Rat Annexin V Crystal Structure: Ca2+-Induced Conformational Changes Length = 316 Back     alignment and structure
>pdb|2RAN|A Chain A, Rat Annexin V Crystal Structure: Ca2+-Induced Conformational Changes Length = 316 Back     alignment and structure
>pdb|1N44|A Chain A, Crystal Structure Of Annexin V R23e Mutant Length = 319 Back     alignment and structure
>pdb|1N44|A Chain A, Crystal Structure Of Annexin V R23e Mutant Length = 319 Back     alignment and structure
>pdb|1N41|A Chain A, Crystal Structure Of Annexin V K27e Mutant Length = 319 Back     alignment and structure
>pdb|1N41|A Chain A, Crystal Structure Of Annexin V K27e Mutant Length = 319 Back     alignment and structure
>pdb|1BCW|A Chain A, Recombinant Rat Annexin V, T72a Mutant Length = 319 Back     alignment and structure
>pdb|1BCW|A Chain A, Recombinant Rat Annexin V, T72a Mutant Length = 319 Back     alignment and structure
>pdb|1BCY|A Chain A, Recombinant Rat Annexin V, T72k Mutant Length = 319 Back     alignment and structure
>pdb|1BCY|A Chain A, Recombinant Rat Annexin V, T72k Mutant Length = 319 Back     alignment and structure
>pdb|1BCZ|A Chain A, Recombinant Rat Annexin V, T72s Mutant Length = 319 Back     alignment and structure
>pdb|1BCZ|A Chain A, Recombinant Rat Annexin V, T72s Mutant Length = 319 Back     alignment and structure
>pdb|1BC0|A Chain A, Recombinant Rat Annexin V, W185a Mutant Length = 319 Back     alignment and structure
>pdb|1BC0|A Chain A, Recombinant Rat Annexin V, W185a Mutant Length = 319 Back     alignment and structure
>pdb|2H0M|A Chain A, Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|2H0M|A Chain A, Structure Of A Mutant Of Rat Annexin A5 Length = 318 Back     alignment and structure
>pdb|1N42|A Chain A, Crystal Structure Of Annexin V R149e Mutant Length = 319 Back     alignment and structure
>pdb|1N42|A Chain A, Crystal Structure Of Annexin V R149e Mutant Length = 319 Back     alignment and structure
>pdb|1YII|A Chain A, Crystal Structures Of Chicken Annexin V In Complex With Ca2+ Length = 320 Back     alignment and structure
>pdb|1YII|A Chain A, Crystal Structures Of Chicken Annexin V In Complex With Ca2+ Length = 320 Back     alignment and structure
>pdb|1BC1|A Chain A, Recombinant Rat Annexin V, Quadruple Mutant (T72k, S144k, S228k, S303k) Length = 319 Back     alignment and structure
>pdb|1BC1|A Chain A, Recombinant Rat Annexin V, Quadruple Mutant (T72k, S144k, S228k, S303k) Length = 319 Back     alignment and structure
>pdb|1M9I|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T356d Of Annexin Vi Length = 672 Back     alignment and structure
>pdb|1M9I|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T356d Of Annexin Vi Length = 672 Back     alignment and structure
>pdb|1HVE|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1HVE|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1HVF|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1HVF|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1ANW|A Chain A, The Effect Of Metal Binding On The Structure Of Annexin V And Implications For Membrane Binding Length = 319 Back     alignment and structure
>pdb|1ANW|A Chain A, The Effect Of Metal Binding On The Structure Of Annexin V And Implications For Membrane Binding Length = 319 Back     alignment and structure
>pdb|1HVD|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1HVD|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 Back     alignment and structure
>pdb|1AVH|A Chain A, Crystal And Molecular Structure Of Human Annexin V After Refinement. Implications For Structure, Membrane Binding And Ion Channel Formation Of The Annexin Family Of Proteins Length = 320 Back     alignment and structure
>pdb|1AVH|A Chain A, Crystal And Molecular Structure Of Human Annexin V After Refinement. Implications For Structure, Membrane Binding And Ion Channel Formation Of The Annexin Family Of Proteins Length = 320 Back     alignment and structure
>pdb|1ALA|A Chain A, Structure Of Chicken Annexin V At 2.25-Angstroms Resolution Length = 321 Back     alignment and structure
>pdb|1ALA|A Chain A, Structure Of Chicken Annexin V At 2.25-Angstroms Resolution Length = 321 Back     alignment and structure
>pdb|2XO2|A Chain A, Human Annexin V With Incorporated Methionine Analogue Azidohomoalanine Length = 320 Back     alignment and structure
>pdb|2XO2|A Chain A, Human Annexin V With Incorporated Methionine Analogue Azidohomoalanine Length = 320 Back     alignment and structure
>pdb|1SAV|A Chain A, Human Annexin V With Proline Substitution By Thioproline Length = 320 Back     alignment and structure
>pdb|1SAV|A Chain A, Human Annexin V With Proline Substitution By Thioproline Length = 320 Back     alignment and structure
>pdb|1XJL|A Chain A, Structure Of Human Annexin A2 In The Presence Of Calcium Ions Length = 319 Back     alignment and structure
>pdb|1XJL|A Chain A, Structure Of Human Annexin A2 In The Presence Of Calcium Ions Length = 319 Back     alignment and structure
>pdb|2HYU|A Chain A, Human Annexin A2 With Heparin Tetrasaccharide Bound Length = 308 Back     alignment and structure
>pdb|2HYU|A Chain A, Human Annexin A2 With Heparin Tetrasaccharide Bound Length = 308 Back     alignment and structure
>pdb|1W7B|A Chain A, Annexin A2: Does It Induce Membrane Aggregation By A New Multimeric State Of The Protein Length = 339 Back     alignment and structure
>pdb|1W7B|A Chain A, Annexin A2: Does It Induce Membrane Aggregation By A New Multimeric State Of The Protein Length = 339 Back     alignment and structure
>pdb|1DM5|A Chain A, Annexin Xii E105k Homohexamer Crystal Structure Length = 315 Back     alignment and structure
>pdb|1DM5|A Chain A, Annexin Xii E105k Homohexamer Crystal Structure Length = 315 Back     alignment and structure
>pdb|1DM5|A Chain A, Annexin Xii E105k Homohexamer Crystal Structure Length = 315 Back     alignment and structure
>pdb|1AEI|A Chain A, Crystal Structure Of The Annexin Xii Hexamer Length = 315 Back     alignment and structure
>pdb|1AEI|A Chain A, Crystal Structure Of The Annexin Xii Hexamer Length = 315 Back     alignment and structure
>pdb|1AEI|A Chain A, Crystal Structure Of The Annexin Xii Hexamer Length = 315 Back     alignment and structure
>pdb|1AIN|A Chain A, Crystal Structure Of Human Annexin I At 2.5 Angstroms Resolution Length = 314 Back     alignment and structure
>pdb|1AIN|A Chain A, Crystal Structure Of Human Annexin I At 2.5 Angstroms Resolution Length = 314 Back     alignment and structure
>pdb|1HM6|A Chain A, X-Ray Structure Of Full-Length Annexin 1 Length = 346 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 1e-65
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 5e-25
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 7e-22
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 5e-15
1n00_A 321 Annexin GH1; membrane-binding, calcium-binding, me 1e-07
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 8e-65
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 1e-27
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 4e-19
1dm5_A 315 Annexin XII E105K mutant homohexamer; novel PH-dep 3e-07
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 1e-64
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 2e-27
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 4e-21
1w3w_A 327 Annexin A8; coagulation, annexin family, calcium a 9e-08
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 2e-64
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 3e-29
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 8e-22
2hyv_A 308 Annexin A2; calcium-binding protein, membrane-bind 6e-08
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 4e-64
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 5e-27
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 5e-21
1hm6_A 346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 1e-07
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 5e-63
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 7e-29
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 1e-19
1axn_A 323 Annexin III; annexin family, calcium/phospholipid- 9e-08
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 5e-62
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 2e-27
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 8e-21
2zhj_A 322 Annexin A4; zynogen granule, membrane binding prot 1e-07
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 2e-61
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 2e-28
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 5e-19
1yii_A 320 Annexin A5, annexin V, lipocortin V, endonexin II; 9e-08
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 7e-60
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 3e-20
2ii2_A 310 Alpha-11 giardin; helix-turn-helix, metal binding 2e-17
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 2e-59
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 5e-58
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 1e-32
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 5e-28
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 7e-22
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 5e-21
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 2e-20
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 4e-08
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 1e-54
3chj_A 337 Alpha-14 giardin; calcium-binding, annexin, metal 4e-23
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 2e-18
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 7e-15
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 2e-50
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 9e-24
4evf_A 295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 2e-22
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
 Score =  205 bits (522), Expect = 1e-65
 Identities = 85/225 (37%), Positives = 131/225 (58%)

Query: 2   AKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKV 61
           A  A + +K      QV++EI+C  S   L   RQAY A +  S+EED+    +    K+
Sbjct: 94  ALLANEATKRWTSSNQVLMEIACTRSANQLLHARQAYHARYKKSLEEDVAHHTTGDFHKL 153

Query: 62  LLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFERY 121
           LL LVSS+RY+ E +++  A +EA  LHE I  K    D V+ +LATR+  Q+ AT   Y
Sbjct: 154 LLPLVSSYRYEGEEVNMTLAKTEAKLLHEKISNKAYSDDDVIRVLATRSKAQINATLNHY 213

Query: 122 EQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRAI 181
           +  +G+ I++D+ +  K + ++L++  + C+  PE++F +V+R +I   GTDE AL R +
Sbjct: 214 KNEYGNDINKDLKADPKDEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGALTRVV 273

Query: 182 ITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGS 226
            TRAEVD+K+I + Y       L   ++ DT GDY+  LL L G 
Sbjct: 274 CTRAEVDLKVIADEYQRRNSVPLTRAIVKDTHGDYEKLLLVLAGH 318
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query228
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 100.0
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 100.0
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 100.0
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 100.0
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 100.0
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 100.0
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 100.0
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 100.0
1m9i_A 672 Annexin VI; calcium-binding, membrane-binding, pho 100.0
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 100.0
1m9i_A672 Annexin VI; calcium-binding, membrane-binding, pho 100.0
1dm5_A315 Annexin XII E105K mutant homohexamer; novel PH-dep 100.0
1w3w_A327 Annexin A8; coagulation, annexin family, calcium a 100.0
1yii_A320 Annexin A5, annexin V, lipocortin V, endonexin II; 100.0
1n00_A321 Annexin GH1; membrane-binding, calcium-binding, me 100.0
2zhj_A322 Annexin A4; zynogen granule, membrane binding prot 100.0
1axn_A323 Annexin III; annexin family, calcium/phospholipid- 100.0
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 100.0
2hyv_A308 Annexin A2; calcium-binding protein, membrane-bind 100.0
1hm6_A346 Annexin 1; phospholipid/Ca(2+)-binding protein, ca 100.0
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 100.0
4evf_A295 Alpha-1 giardin, giardin subunit alpha-1; annexin, 100.0
2ii2_A310 Alpha-11 giardin; helix-turn-helix, metal binding 100.0
3chj_A337 Alpha-14 giardin; calcium-binding, annexin, metal 100.0
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Back     alignment and structure
Probab=100.00  E-value=1.7e-61  Score=413.94  Aligned_cols=223  Identities=29%  Similarity=0.445  Sum_probs=218.4

Q ss_pred             HHHHhcCCCCCCCCHHHHHHHHhcCCHHHHHHHHHHHHhhhcccHHHHHHhccCchHHHHHHHHhhhccCCchhhCHHHH
Q 027102            2 AKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYDKELLDIEAA   81 (228)
Q Consensus         2 l~~A~kg~~~~gtde~~li~il~~rs~~~~~~i~~~Y~~~~~~~L~~di~~~~sg~~~~ll~~ll~~~r~e~~~i~~~~~   81 (228)
                      ||+||||   +||||.+||+|||+|||+|+++|+++|+..||++|++||.+++||+|++++++|+.++|+|+..||++.+
T Consensus        99 L~~A~kG---~Gtde~~lieIL~~Rs~~q~~~I~~aY~~~y~~~Le~di~se~sG~~~~ll~~l~~~~R~e~~~vd~~~a  175 (323)
T 1axn_A           99 LKKSMKG---AGTNEDALIEILTTRTSRQMKDISQAYYTVYKKSLGDDISSETSGDFRKALLTLADGRRDESLKVDEHLA  175 (323)
T ss_dssp             HHHHHCS---SSCCHHHHHHHHHHSCHHHHHHHHHHHHHHHSSCHHHHHHHHCCHHHHHHHHHHHTTCSCCCSCCCHHHH
T ss_pred             HHHHhcc---CCCCHHHHhHHhcCCCHHHHHHHHHHHHHhhCcCHHHHHHHhcCcHHHHHHHHHHhcccccCCCCCccHH
Confidence            7999999   9999999999999999999999999999999999999999999999999999999999999888999999


Q ss_pred             HHHHHHHHHhhh-cCCCCHHHHHHHhhcCCHHHHHHHHHHHHHhhCCChHHhhhhcccCcHHHHHHHHHHHhcChhhhHH
Q 027102           82 ASEANQLHEAIK-AKQLDHDQVVHILATRNFFQLKATFERYEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFA  160 (228)
Q Consensus        82 ~~da~~L~~a~~-g~~~d~~~li~il~~rs~~~l~~i~~~Y~~~~g~~L~~~i~~~~~g~~~~~l~~lv~~~~~~~~~~A  160 (228)
                      +.||+.|++|++ +.|+|+.++|+||++||+.|+++|+++|++.||++|+++|++++||+|+.+|+++++|.++|+.++|
T Consensus       176 ~~DA~~L~~A~~~~~Gtde~~li~Il~tRs~~~L~~i~~~Y~~~~g~~Le~~I~~e~sG~~~~~Ll~lv~~~r~~~~~~A  255 (323)
T 1axn_A          176 KQDAQILYKAGENRWGTDEDKFTEILCLRSFPQLKLTFDEYRNISQKDIVDSIKGELSGHFEDLLLAIVNCVRNTPAFLA  255 (323)
T ss_dssp             HHHHHHHHHHTTTSSSCCHHHHHHHHHHSCHHHHHHHHHHHHHHHSSCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhccCCCCCHHHHHHHHHhCCHHHHHHHHHHHHHHHCcCHHHHHhHhcCchHHHHHHHHHHhcCCccHHHH
Confidence            999999999995 5788888999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhccCCCchHHHHHHHHhcCHHHHHHHHHHHhhhhCCChHHhhhhcccHHHHHHHHHhhccC
Q 027102          161 EVIRTSIVGFGTDEAALNRAIITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGSK  227 (228)
Q Consensus       161 ~~L~~A~~g~gtd~~~li~il~~rs~~~l~~i~~~Y~~~yg~sL~~~I~~~~sG~~~~~Ll~l~~~~  227 (228)
                      ..|++||+|+|||+++||||+++||+.||..|+++|+++||++|+++|++++||+|+++|++||+++
T Consensus       256 ~~L~~A~~g~GTde~~lirilv~Rs~~~L~~i~~~Y~~~yg~~L~~~I~~e~sGdy~~~Llal~~~~  322 (323)
T 1axn_A          256 ERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLYSAIKSDTSGDYEITLLKICGGD  322 (323)
T ss_dssp             HHHHHHHSSSSCCHHHHHHHHHHHTTTTHHHHHHHHHHHHSSCHHHHHHHHCCHHHHHHHHHHHCSC
T ss_pred             HHHHHhcccCCCCHHHhhhhhhhCCHHHHHHHHHHHHHHcCCcHHHHHhhhCChHHHHHHHHHhCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999999865
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Back     alignment and structure
>1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Back     alignment and structure
>1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Back     alignment and structure
>1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Back     alignment and structure
>1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Back     alignment and structure
>1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Back     alignment and structure
>2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Back     alignment and structure
>1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Back     alignment and structure
>2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Back     alignment and structure
>1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Back     alignment and structure
>4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Back     alignment and structure
>2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Back     alignment and structure
>3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 228
d1n00a_318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 4e-58
d1n00a_ 318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 5e-23
d1n00a_318 a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu 4e-20
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 8e-57
d1dm5a_ 315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 9e-23
d1dm5a_315 a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 4e-19
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 5e-56
d2ie7a1 318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 5e-27
d2ie7a1318 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic 2e-21
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 7e-56
d1axna_ 323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 3e-27
d1axna_323 a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T 2e-18
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 6e-55
d1i4aa_ 309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 2e-26
d1i4aa_309 a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 1e-20
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 7e-55
d1w7ba_ 319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 9e-25
d1w7ba_319 a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta 4e-20
d1avca1341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 7e-55
d1avca1 341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 5e-26
d1avca1341 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ 3e-19
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 4e-54
d1hm6a_ 343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 2e-26
d1hm6a_343 a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 3e-19
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 1e-51
d1avca2 321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 8e-25
d1avca2321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 3e-16
d1avca2 321 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) 2e-08
d1bo9a_73 a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax 3e-17
d1bo9a_73 a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax 1e-10
d1bo9a_73 a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax 1e-05
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure

class: All alpha proteins
fold: Annexin
superfamily: Annexin
family: Annexin
domain: Annexin GH1
species: Cotton (Gossypium hirsutum) [TaxId: 3635]

 Score =  184 bits (468), Expect = 4e-58
 Identities = 86/225 (38%), Positives = 132/225 (58%), Gaps = 3/225 (1%)

Query: 1   MAKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRK 60
           +A EA K+        QV++EI+C  S   L   RQAY A +  S+EED+    +    K
Sbjct: 93  LANEATKR---WTSSNQVLMEIACTRSANQLLHARQAYHARYKKSLEEDVAHHTTGDFHK 149

Query: 61  VLLRLVSSFRYDKELLDIEAAASEANQLHEAIKAKQLDHDQVVHILATRNFFQLKATFER 120
           +LL LVSS+RY+ E +++  A +EA  LHE I  K    D V+ +LATR+  Q+ AT   
Sbjct: 150 LLLPLVSSYRYEGEEVNMTLAKTEAKLLHEKISNKAYSDDDVIRVLATRSKAQINATLNH 209

Query: 121 YEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHFAEVIRTSIVGFGTDEAALNRA 180
           Y+  +G+ I++D+ +  K + ++L++  + C+  PE++F +V+R +I   GTDE AL R 
Sbjct: 210 YKNEYGNDINKDLKADPKDEFLALLRSTVKCLVYPEKYFEKVLRLAINRRGTDEGALTRV 269

Query: 181 IITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTG 225
           + TRAEVD+K+I + Y       L   ++ DT GDY+  LL L G
Sbjct: 270 VCTRAEVDLKVIADEYQRRNSVPLTRAIVKDTHGDYEKLLLVLAG 314
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query228
d1i4aa_309 Annexin IV {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1axna_323 Annexin III {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1avca1341 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1n00a_318 Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 100.0
d1w7ba_319 Annexin II {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1hm6a_343 Annexin I {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d2ie7a1318 Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1dm5a_315 Annexin XII {Hydra vulgaris [TaxId: 6087]} 100.0
d1avca2321 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1dm5a_315 Annexin XII {Hydra vulgaris [TaxId: 6087]} 100.0
d1axna_323 Annexin III {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1i4aa_309 Annexin IV {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1w7ba_319 Annexin II {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1avca1341 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1hm6a_343 Annexin I {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1n00a_318 Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 100.0
d2ie7a1318 Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} 100.0
d1avca2321 Annexin VI {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1bo9a_73 Annexin I {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1bo9a_73 Annexin I {Human (Homo sapiens) [TaxId: 9606]} 99.75
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All alpha proteins
fold: Annexin
superfamily: Annexin
family: Annexin
domain: Annexin IV
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=8.2e-61  Score=405.43  Aligned_cols=224  Identities=29%  Similarity=0.459  Sum_probs=219.1

Q ss_pred             CHHHHhcCCCCCCCCHHHHHHHHhcCCHHHHHHHHHHHHhhhcccHHHHHHhccCchHHHHHHHHhhhccCCchhhCHHH
Q 027102            1 MAKEALKKSKSGVKHLQVIVEISCASSPYHLAAVRQAYCALFDCSIEEDITAVVSMPLRKVLLRLVSSFRYDKELLDIEA   80 (228)
Q Consensus         1 ~l~~A~kg~~~~gtde~~li~il~~rs~~~~~~i~~~Y~~~~~~~L~~di~~~~sg~~~~ll~~ll~~~r~e~~~i~~~~   80 (228)
                      +||+||||   +||||.+|++|||+|||.|+.+|+++|+..||++|++||.+++||+|++++++|+.+.|+|+..||+..
T Consensus        84 ~l~~A~kG---~gtde~~LieIl~trs~~e~~~ik~aY~~~~~~sL~~di~~~~sg~~~~ll~~ll~~~R~e~~~vd~~~  160 (309)
T d1i4aa_          84 ELRKAMKG---AGTDEGCLIEILASRTPEEIRRINQTYQLQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDESNYLDDAL  160 (309)
T ss_dssp             HHHHHHSS---SSCCHHHHHHHHHHSCHHHHHHHHHHHHHHHSSCHHHHHHHHCCHHHHHHHHHHHTTCSCCSCCCCHHH
T ss_pred             HHHHHhcC---CCCchHHhhhhheeCCHHHHHHHHHHHHHhcCCCHHHHhhhCCcHhHHHHHHHHHhcccCCCCCcCHHH
Confidence            37999998   999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhhhcC-CCCHHHHHHHhhcCCHHHHHHHHHHHHHhhCCChHHhhhhcccCcHHHHHHHHHHHhcChhhhH
Q 027102           81 AASEANQLHEAIKAK-QLDHDQVVHILATRNFFQLKATFERYEQMHGSPIDEDISSVGKGDLVSLMKMVILCIRCPERHF  159 (228)
Q Consensus        81 ~~~da~~L~~a~~g~-~~d~~~li~il~~rs~~~l~~i~~~Y~~~~g~~L~~~i~~~~~g~~~~~l~~lv~~~~~~~~~~  159 (228)
                      ++.||+.|++|+++. |+|++++++||++||+.||++|+++|++.||++|.++|+++++|+|+.+|++++.|+.||+.++
T Consensus       161 a~~DA~~L~~A~~~~~g~De~~~i~Il~~rs~~ql~~i~~~Y~~~~g~~l~~~i~~e~sG~~~~al~~~v~~~~~p~~~~  240 (309)
T d1i4aa_         161 MRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRIAQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYF  240 (309)
T ss_dssp             HHHHHHHHHHHTTCSSCCCHHHHHHHHHHSCHHHHHHHHHHHHHHHSSCHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhCcCCCChhHeeeeeecCCHHHHHHHHHHHHHHhCccHHHHHHHHcCCcHHHHHHHHHHHhcCHHHHH
Confidence            999999999999876 5688899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhccCCCchHHHHHHHHhcCHHHHHHHHHHHhhhhCCChHHhhhhcccHHHHHHHHHhhccC
Q 027102          160 AEVIRTSIVGFGTDEAALNRAIITRAEVDMKLIKEVYPIMYKNTLEDDVIGDTSGDYQDFLLTLTGSK  227 (228)
Q Consensus       160 A~~L~~A~~g~gtd~~~li~il~~rs~~~l~~i~~~Y~~~yg~sL~~~I~~~~sG~~~~~Ll~l~~~~  227 (228)
                      |..|+.||+|+|||+.+||||+|+|++.||..|+.+|+++||++|+++|+++|||+|+++|++||+++
T Consensus       241 A~~L~~Am~g~gtd~~~LiriivtR~e~dl~~Ik~~Y~~~yg~~L~~~i~~etsG~y~~~Ll~L~~~~  308 (309)
T d1i4aa_         241 AERLYKSMKGLGTDDDTLIRVMVSRAEIDMLDIRANFKRLYGKSLYSFIKGDTSGDYRKVLLILCGGD  308 (309)
T ss_dssp             HHHHHHHHSSSSCCHHHHHHHHHHHTTTTHHHHHHHHHHHHSSCHHHHHHHHCCHHHHHHHHHHHTSC
T ss_pred             HHHHHHHccCCCCChHhHhhhhhcccHHHHHHHHHHHHHHhCCcHHHHHHhhCCcHHHHHHHHHhCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999986
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Back     information, alignment and structure
>d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Back     information, alignment and structure
>d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure