Citrus Sinensis ID: 027103

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23

MEGKEEDVKLGANKFSERQPIGTSAQSDKDYKEPPPAPLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPVSILSPCHSLSSFLRYKYC

cccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHEECcccccccccccccccccccccHHHHHHHHHHHHHHHHEEEEECcccccccccccHHHHHHHHHHcccccccccc

*************************************PLFEPGELKSWSFYRAGIAEFMATFLFLYITVLTVMGVSKSNTKCSTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAVCGAGVVKGFEGSKNYERLGGGANVVAHGYTKGDGLGAEIIGTFVLVYTVFSATDAKRNARDSHVPVSILSPCHSLSSFLRYKYC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable aquaporin PIP1-2	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	probable	Q7XSQ9
Aquaporin PIP1-3/PIP1-4	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	probable	Q9AQU5
Probable aquaporin PIP-type 7a	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	probable	P25794

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CN5, chain A
Confidence level:very confident
Coverage over the Query: 45-221
View the alignment between query and template
View the model in PyMOL