Citrus Sinensis ID: 027126


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MVEPSPPSPSLQIPNHMVPPPLDPQPQPSPSPPQPQQQRTSSLFSFPSRPALRVTSEFDSDSSIFLHKISCKLFDSLAKLKVSFQNDNKGQIFEPQLAFTSKHLSLHYDLEEQNAFVKSSFDVGPKLHFRAAHDVKAQQGEVGVVANLGDPGYALELSSPVPYVGYPKATFKFPLGEVSLVEREEEEVKKTLSISGIAKGQILNGICTAQYEEEDLKLRYCYKLLVQF
cccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccEEEEEEHHHHccccccEEEEEECcccccccccEEEEEEEcEEEEEEcccccEEEEECccccccEEEEEEccccccccEEEEEEEccccccEEEECccccccccccEEEECcccEEEcHHHHHHHHccEEEEEcEEccEEEccEEEEEEccccccEEEEEEEEEcc
*********************************************FPSRPALRVTSEFDSDSSIFLHKISCKLFDSLAKLKVSFQNDNKGQIFEPQLAFTSKHLSLHYDLEEQNAFVKSSFDVGPKLHFRAAHDVKAQQGEVGVVANLGDPGYALELSSPVPYVGYPKATFKFPLGEVS***********TLSISGIAKGQILNGICTAQYEEEDLKLRYCYKLLVQF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEPSPPSPSLQIPNHMVPPPLDPQPQPSPSPPQPQQQRTSSLFSFPSRPALRVTSEFDSDSSIFLHKISCKLFDSLAKLKVSFQNDNKGQIFEPQLAFTSKHLSLHYDLEEQNAFVKSSFDVGPKLHFRAAHDVKAQQGEVGVVANLGDPGYALELSSPVPYVGYPKATFKFPLGEVSLVEREEEEVKKTLSISGIAKGQILNGICTAQYEEEDLKLRYCYKLLVQF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Outer envelope pore protein 37, chloroplastic Voltage-dependent peptide-sensitive high conductance rectifying cation channel with a strong affinity for TIC32 that is imported into the chloroplast. Conductance is pH-dependent decreasing with decreasing pH values.probableO80565

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted