Citrus Sinensis ID: 027200


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MAVAFDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRISGVTGEGSGVTVEGSAPVATPPVADSKATAPDDDDDDVDLFGEETEEEKKAAEARAASVKASAKKKESGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI
ccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccEEEEccccccHHcHHHHHHHHcccccccEEEcccccccccEEEEEEEEEEEEEcccccHHHHHHHHHccccccccccccccEEcccc
ccccccccccHHHHHHHHHHHccccEEEcccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEcccccccHHHHHHHHHccccccEEEEEEEEEEEEccEEEEEEEEEEEcccccHHHHHHHHHHHcHHHHHccHHHHHHHccc
mavafdnvnsatglkkldeYLLTRSYItgyqaskddITVYSAlskapsseyvnvsrWYKHIDALLRIsgvtgegsgvtvegsapvatppvadskatapddddddvdlfgEETEEEKKAAEARAASVKASAKkkesgkssvlldvkpwddetdMKKLEEAVRSVQMEGLLwgasklapvgygIKKLQIMLTIVDDLVSVDTLIEehlleepineyvqSCDIVAFNKI
mavafdnvnsatglkkldeYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRISGVTGEGSGVTVegsapvatppvadskatapdddddDVDLFGEETEEEKKAAEARAAsvkasakkkesgkssvlldvkpwddetDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEhlleepineyvqscdivafnki
MAVAFDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRIsgvtgegsgvtvegsAPVATPPVADSKATAPddddddvdLFGeeteeekkaaearaasvkasakkkesgkssVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI
*********SATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRISGVTGE**************************************************************************************VRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAF***
*AVAFDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRISGVTGEGSGVTVEGSAPVATPPV*****************************************************VKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI
MAVAFDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRISGVTGEGSGVTVEGSAPVATPPVADSKATAPDDDDDDVDLFGE****************************SVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI
****FDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRIS*************************************DLFGEETEEEKKAAEARAASVKASAKKKESGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVAFDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDALLRISGVTGEGSGVTVEGSAPVATPPVADSKATAPDDDDDDVDLFxxxxxxxxxxxxxxxxxxxxxAKKKESGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query226 2.2.26 [Sep-21-2011]
P93447226 Elongation factor 1-delta N/A no 0.995 0.995 0.779 3e-94
Q9SI20231 Elongation factor 1-delta yes no 0.986 0.965 0.807 2e-91
P48006231 Elongation factor 1-delta no no 0.986 0.965 0.803 2e-86
Q40682226 Elongation factor 1-delta yes no 0.995 0.995 0.757 7e-80
Q40680229 Elongation factor 1-delta no no 1.0 0.986 0.755 7e-80
O81918231 Elongation factor 1-delta N/A no 1.0 0.978 0.783 4e-76
P29545224 Elongation factor 1-beta no no 0.991 1.0 0.632 9e-63
Q84WM9228 Elongation factor 1-beta no no 0.995 0.986 0.606 2e-61
Q9SCX3224 Elongation factor 1-beta no no 0.991 1.0 0.606 2e-54
P29546216 Elongation factor 1-beta N/A no 0.955 1.0 0.592 2e-54
>sp|P93447|EF1D_PIMBR Elongation factor 1-delta OS=Pimpinella brachycarpa PE=2 SV=3 Back     alignment and function desciption
 Score =  344 bits (882), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 177/227 (77%), Positives = 204/227 (89%), Gaps = 2/227 (0%)

Query: 1   MAVAFDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKH 60
           MAV F +++S  GL+KLDEYLL+RSYI+GYQASKDD+ V++AL+K PSS+YVNVSRWY H
Sbjct: 1   MAVTFYDLSSEAGLEKLDEYLLSRSYISGYQASKDDLAVHAALAKPPSSKYVNVSRWYNH 60

Query: 61  IDALLRISGVTGEGSGVTVEGSAPVATPPVADSKATAPDDDDDDVD-LFGEETEEEKKAA 119
           ++ALLRISGV+ EG GVTVEGS+ VATPPVAD+KA+A +DDDDD   LFGEETEEEKKA+
Sbjct: 61  VEALLRISGVSAEGCGVTVEGSS-VATPPVADTKASAAEDDDDDDVDLFGEETEEEKKAS 119

Query: 120 EARAASVKASAKKKESGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVG 179
           E RAA+VKAS KKKESGKSSVLLDVKPWDDETDM KLEEAVRS++M+GLLWGASKL  VG
Sbjct: 120 EERAAAVKASGKKKESGKSSVLLDVKPWDDETDMTKLEEAVRSIKMDGLLWGASKLVAVG 179

Query: 180 YGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 226
           YGIKKLQIMLTIVDDLVSVD L+E++L  EP NEY+QSCDIVAFNKI
Sbjct: 180 YGIKKLQIMLTIVDDLVSVDDLVEDYLTAEPANEYIQSCDIVAFNKI 226




EF-1-beta and EF-1-beta' stimulate the exchange of GDP bound to EF-1-alpha to GTP.
Pimpinella brachycarpa (taxid: 45043)
>sp|Q9SI20|EF1D2_ARATH Elongation factor 1-delta 2 OS=Arabidopsis thaliana GN=At2g18110 PE=2 SV=1 Back     alignment and function description
>sp|P48006|EF1D1_ARATH Elongation factor 1-delta 1 OS=Arabidopsis thaliana GN=At1g30230 PE=2 SV=2 Back     alignment and function description
>sp|Q40682|EF1D2_ORYSJ Elongation factor 1-delta 2 OS=Oryza sativa subsp. japonica GN=Os03g0406200 PE=2 SV=3 Back     alignment and function description
>sp|Q40680|EF1D1_ORYSJ Elongation factor 1-delta 1 OS=Oryza sativa subsp. japonica GN=Os07g0614500 PE=2 SV=3 Back     alignment and function description
>sp|O81918|EF1D_BETVU Elongation factor 1-delta OS=Beta vulgaris PE=2 SV=3 Back     alignment and function description
>sp|P29545|EF1B_ORYSJ Elongation factor 1-beta OS=Oryza sativa subsp. japonica GN=Os07g0662500 PE=1 SV=3 Back     alignment and function description
>sp|Q84WM9|EF1B1_ARATH Elongation factor 1-beta 1 OS=Arabidopsis thaliana GN=At5g12110 PE=2 SV=2 Back     alignment and function description
>sp|Q9SCX3|EF1B2_ARATH Elongation factor 1-beta 2 OS=Arabidopsis thaliana GN=At5g19510 PE=1 SV=1 Back     alignment and function description
>sp|P29546|EF1B_WHEAT Elongation factor 1-beta OS=Triticum aestivum PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
6015064226 RecName: Full=Elongation factor 1-delta; 0.995 0.995 0.779 2e-92
118197456230 putative elongation factor 1-beta [Brass 0.986 0.969 0.833 3e-90
21593028231 putative elongation factor beta-1 [Arabi 0.986 0.965 0.807 8e-90
378464888231 translation elongation factor [Ammopipta 1.0 0.978 0.831 1e-89
15224107231 Elongation factor 1-delta 2 [Arabidopsis 0.986 0.965 0.807 1e-89
224995910233 seed ripening regulated protein [Camelli 1.0 0.969 0.811 2e-89
225456295230 PREDICTED: elongation factor 1-delta-lik 1.0 0.982 0.843 3e-89
297734404245 unnamed protein product [Vitis vinifera] 1.0 0.922 0.843 3e-89
356516563230 PREDICTED: elongation factor 1-delta-lik 1.0 0.982 0.860 6e-89
388519683232 unknown [Lotus japonicus] 1.0 0.974 0.810 4e-88
>gi|6015064|sp|P93447.3|EF1D_PIMBR RecName: Full=Elongation factor 1-delta; Short=EF-1-delta; AltName: Full=Elongation factor 1B-beta; AltName: Full=eEF-1B beta gi|1841870|gb|AAB68395.1| elongation factor 1-beta [Pimpinella brachycarpa] Back     alignment and taxonomy information
 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 177/227 (77%), Positives = 204/227 (89%), Gaps = 2/227 (0%)

Query: 1   MAVAFDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKH 60
           MAV F +++S  GL+KLDEYLL+RSYI+GYQASKDD+ V++AL+K PSS+YVNVSRWY H
Sbjct: 1   MAVTFYDLSSEAGLEKLDEYLLSRSYISGYQASKDDLAVHAALAKPPSSKYVNVSRWYNH 60

Query: 61  IDALLRISGVTGEGSGVTVEGSAPVATPPVADSKATAPDDDDDDVD-LFGEETEEEKKAA 119
           ++ALLRISGV+ EG GVTVEGS+ VATPPVAD+KA+A +DDDDD   LFGEETEEEKKA+
Sbjct: 61  VEALLRISGVSAEGCGVTVEGSS-VATPPVADTKASAAEDDDDDDVDLFGEETEEEKKAS 119

Query: 120 EARAASVKASAKKKESGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVG 179
           E RAA+VKAS KKKESGKSSVLLDVKPWDDETDM KLEEAVRS++M+GLLWGASKL  VG
Sbjct: 120 EERAAAVKASGKKKESGKSSVLLDVKPWDDETDMTKLEEAVRSIKMDGLLWGASKLVAVG 179

Query: 180 YGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 226
           YGIKKLQIMLTIVDDLVSVD L+E++L  EP NEY+QSCDIVAFNKI
Sbjct: 180 YGIKKLQIMLTIVDDLVSVDDLVEDYLTAEPANEYIQSCDIVAFNKI 226




Source: Pimpinella brachycarpa

Species: Pimpinella brachycarpa

Genus: Pimpinella

Family: Apiaceae

Order: Apiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|118197456|gb|ABK78691.1| putative elongation factor 1-beta [Brassica rapa] Back     alignment and taxonomy information
>gi|21593028|gb|AAM64977.1| putative elongation factor beta-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|378464888|gb|AFC01201.1| translation elongation factor [Ammopiptanthus mongolicus] Back     alignment and taxonomy information
>gi|15224107|ref|NP_179402.1| Elongation factor 1-delta 2 [Arabidopsis thaliana] gi|13124232|sp|Q9SI20.1|EF1D2_ARATH RecName: Full=Elongation factor 1-delta 2; Short=EF-1-delta 2; AltName: Full=Elongation factor 1B-beta 2; AltName: Full=eEF-1B beta 2 gi|4874292|gb|AAD31355.1| putative elongation factor beta-1 [Arabidopsis thaliana] gi|17473804|gb|AAL38335.1| putative elongation factor 1-beta [Arabidopsis thaliana] gi|20148479|gb|AAM10130.1| putative elongation factor 1-beta [Arabidopsis thaliana] gi|20197598|gb|AAM15146.1| putative elongation factor beta-1 [Arabidopsis thaliana] gi|330251633|gb|AEC06727.1| Elongation factor 1-delta 2 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224995910|gb|ACN76858.1| seed ripening regulated protein [Camellia oleifera] Back     alignment and taxonomy information
>gi|225456295|ref|XP_002283673.1| PREDICTED: elongation factor 1-delta-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297734404|emb|CBI15651.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356516563|ref|XP_003526963.1| PREDICTED: elongation factor 1-delta-like [Glycine max] Back     alignment and taxonomy information
>gi|388519683|gb|AFK47903.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
TAIR|locus:2053144231 AT2G18110 [Arabidopsis thalian 0.986 0.965 0.620 1.9e-67
TAIR|locus:2009807260 eEF-1Bb1 "eukaryotic elongatio 0.986 0.857 0.615 3.1e-67
TAIR|locus:2177038228 AT5G12110 [Arabidopsis thalian 1.0 0.991 0.469 1.8e-46
TAIR|locus:2180806224 AT5G19510 [Arabidopsis thalian 0.991 1.0 0.460 3.8e-46
FB|FBgn0028737222 Ef1beta "Elongation factor 1 b 0.371 0.378 0.678 2.8e-42
UNIPROTKB|Q5E983225 EEF1B "Elongation factor 1-bet 0.371 0.373 0.643 2.4e-37
UNIPROTKB|F1NYA9224 EEF1B2 "Uncharacterized protei 0.371 0.375 0.632 3.1e-37
UNIPROTKB|P24534225 EEF1B2 "Elongation factor 1-be 0.371 0.373 0.632 4e-37
ZFIN|ZDB-GENE-030131-7310225 eef1b2 "eukaryotic translation 0.371 0.373 0.655 4e-37
UNIPROTKB|Q9YGQ1225 EEF1B "Elongation factor 1-bet 0.371 0.373 0.632 6.4e-37
TAIR|locus:2053144 AT2G18110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 685 (246.2 bits), Expect = 1.9e-67, P = 1.9e-67
 Identities = 142/229 (62%), Positives = 156/229 (68%)

Query:     4 AFDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVSRWYKHIDA 63
             AF N+NS +GLKKLDE+LLTRSYITGYQASKDDITV++ALSK P+SE+VNVSRW+ HIDA
Sbjct:     3 AFPNLNSGSGLKKLDEHLLTRSYITGYQASKDDITVFTALSKPPTSEFVNVSRWFNHIDA 62

Query:    64 LLRIXXXXXXXXXXXXXXXAP-----VATPPVADSKATAPXXXXXXXX-LFGXXXXXXXX 117
             LLRI               +P     VATPP ADSK TA          LFG        
Sbjct:    63 LLRISGVSAEGSGVIVEGSSPITEEAVATPPAADSKDTAAEEEDDDDVDLFGEETEEEKK 122

Query:   118 XXXXXXXXXXXXXXXXXXXXXXVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAP 177
                                   VL+D+KPWDDETDMKKLEEAVRS+QMEGL WGASKL P
Sbjct:   123 AAEERAASVKASTKKKESGKSSVLMDIKPWDDETDMKKLEEAVRSIQMEGLFWGASKLVP 182

Query:   178 VGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 226
             VGYGIKKL IM TIVDDLVS+DT+IEE L  EPINEYVQSCDIVAFNKI
Sbjct:   183 VGYGIKKLHIMCTIVDDLVSIDTMIEEQLTVEPINEYVQSCDIVAFNKI 231




GO:0003746 "translation elongation factor activity" evidence=IEA;ISS
GO:0005853 "eukaryotic translation elongation factor 1 complex" evidence=IEA;ISS
GO:0005886 "plasma membrane" evidence=ISM
GO:0006414 "translational elongation" evidence=IEA;ISS
GO:0005829 "cytosol" evidence=IDA
TAIR|locus:2009807 eEF-1Bb1 "eukaryotic elongation factor 1B beta 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177038 AT5G12110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180806 AT5G19510 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0028737 Ef1beta "Elongation factor 1 beta" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5E983 EEF1B "Elongation factor 1-beta" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYA9 EEF1B2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P24534 EEF1B2 "Elongation factor 1-beta" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7310 eef1b2 "eukaryotic translation elongation factor 1 beta 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9YGQ1 EEF1B "Elongation factor 1-beta" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9YGQ1EF1B_CHICKNo assigned EC number0.44780.96900.9733yesno
O74173EF1B_SCHPONo assigned EC number0.41730.92030.9719yesno
P34826EF1B_RABITNo assigned EC number0.45450.96460.9688yesno
Q6DET9EF1B_XENTRNo assigned EC number0.47610.97780.9692yesno
Q9GRF8EF1B_DICDINo assigned EC number0.37990.92030.9629yesno
O81918EF1D_BETVUNo assigned EC number0.78351.00.9783N/Ano
Q40682EF1D2_ORYSJNo assigned EC number0.75770.99550.9955yesno
Q40680EF1D1_ORYSJNo assigned EC number0.75541.00.9868nono
O70251EF1B_MOUSENo assigned EC number0.44150.96460.9688yesno
P29546EF1B_WHEATNo assigned EC number0.59290.95571.0N/Ano
P24534EF1B_HUMANNo assigned EC number0.44780.96900.9733yesno
P93447EF1D_PIMBRNo assigned EC number0.77970.99550.9955N/Ano
P34460EF1B1_CAEELNo assigned EC number0.40520.89820.9530yesno
Q5E983EF1B_BOVINNo assigned EC number0.45210.96900.9733yesno
Q9SI20EF1D2_ARATHNo assigned EC number0.80780.98670.9653yesno
P48006EF1D1_ARATHNo assigned EC number0.80340.98670.9653nono

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
AT2G18110
elongation factor 1-beta, putative / EF-1-beta, putative; elongation factor 1-beta, putative / EF-1-beta, putative; FUNCTIONS IN- translation elongation factor activity; INVOLVED IN- translational elongation; LOCATED IN- eukaryotic translation elongation factor 1 complex; EXPRESSED IN- male gametophyte, pollen tube; EXPRESSED DURING- L mature pollen stage, M germinated pollen stage; CONTAINS InterPro DOMAIN/s- Translation elongation factor EF1B/ribosomal protein S6 (InterPro-IPR014717), Translation elongation factor EF1B, beta and delta chains, guanine nucleotide exchange (InterPro-IPR [...] (231 aa)
(Arabidopsis thaliana)
Predicted Functional Partners:
AT1G57720
elongation factor 1B-gamma, putative / eEF-1B gamma, putative; elongation factor 1B-gamma, puta [...] (413 aa)
     0.922
AT1G09640
elongation factor 1B-gamma, putative / eEF-1B gamma, putative; elongation factor 1B-gamma, puta [...] (414 aa)
     0.663
AT2G17360
40S ribosomal protein S4 (RPS4A); 40S ribosomal protein S4 (RPS4A); FUNCTIONS IN- structural co [...] (261 aa)
       0.546
AT5G39850
40S ribosomal protein S9 (RPS9C); 40S ribosomal protein S9 (RPS9C); FUNCTIONS IN- structural co [...] (197 aa)
       0.545
AT5G23900
60S ribosomal protein L13 (RPL13D); 60S ribosomal protein L13 (RPL13D); FUNCTIONS IN- structura [...] (206 aa)
       0.524
AT1G30230
elongation factor 1-beta / EF-1-beta; elongation factor 1-beta / EF-1-beta; FUNCTIONS IN- trans [...] (260 aa)
    0.523
ACT11
ACT11 (actin-11); structural constituent of cytoskeleton; Encodes an actin that is expressed pr [...] (377 aa)
       0.504
AT2G44860
60S ribosomal protein L24, putative; 60S ribosomal protein L24, putative; FUNCTIONS IN- structu [...] (159 aa)
       0.457
AT3G04840
40S ribosomal protein S3A (RPS3aA); 40S ribosomal protein S3A (RPS3aA); FUNCTIONS IN- structura [...] (262 aa)
       0.428
AT3G62870
60S ribosomal protein L7A (RPL7aB); 60S ribosomal protein L7A (RPL7aB); FUNCTIONS IN- structura [...] (256 aa)
       0.428

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
cd0029288 cd00292, EF1B, Elongation factor 1 beta (EF1B) gua 2e-34
pfam0073687 pfam00736, EF1_GNE, EF-1 guanine nucleotide exchan 2e-30
smart0088888 smart00888, EF1_GNE, EF-1 guanine nucleotide excha 8e-27
cd1030882 cd10308, GST_C_eEF1b_like, Glutathione S-transfera 1e-19
COG209288 COG2092, EFB1, Translation elongation factor EF-1b 8e-15
cd1031073 cd10310, GST_C_CysRS_N, Glutathione S-transferase 3e-12
cd1028982 cd10289, GST_C_AaRS_like, Glutathione S-transferas 8e-10
cd10305101 cd10305, GST_C_AIMP3, Glutathione S-transferase C- 1e-08
cd1030687 cd10306, GST_C_GluRS_N, Glutathione S-transferase 3e-08
cd1030981 cd10309, GST_C_GluProRS_N, Glutathione S-transfera 6e-07
cd03181123 cd03181, GST_C_EF1Bgamma_like, Glutathione S-trans 2e-06
PLN02907 722 PLN02907, PLN02907, glutamate-tRNA ligase 6e-06
cd03182116 cd03182, GST_C_GTT2_like, C-terminal, alpha helica 0.001
cd03206100 cd03206, GST_C_7, C-terminal, alpha helical domain 0.004
>gnl|CDD|238181 cd00292, EF1B, Elongation factor 1 beta (EF1B) guanine nucleotide exchange domain Back     alignment and domain information
 Score =  118 bits (297), Expect = 2e-34
 Identities = 45/92 (48%), Positives = 60/92 (65%), Gaps = 4/92 (4%)

Query: 135 SGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDD 194
             KS V+L VKPWDDE D+ +LEE +R++ M+GLLWG SKL P+ +G+K LQI   + DD
Sbjct: 1   MAKSLVVLKVKPWDDEVDLDELEEKIRAILMDGLLWGKSKLEPIAFGLKALQIYCVVEDD 60

Query: 195 LVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 226
               D L E   + E   + VQS D+ AFNK+
Sbjct: 61  EGGTDELEEA--ISE--EDGVQSVDVEAFNKL 88


EF1B catalyzes the exchange of GDP bound to the G-protein, EF1A, for GTP, an important step in the elongation cycle of the protein biosynthesis. EF1A binds to and delivers the aminoacyl tRNA to the ribosome. The guanine nucleotide exchange domain of EF1B, which is the alpha subunit in yeast, is responsible for the catalysis of this exchange reaction. Length = 88

>gnl|CDD|201421 pfam00736, EF1_GNE, EF-1 guanine nucleotide exchange domain Back     alignment and domain information
>gnl|CDD|214886 smart00888, EF1_GNE, EF-1 guanine nucleotide exchange domain Back     alignment and domain information
>gnl|CDD|198341 cd10308, GST_C_eEF1b_like, Glutathione S-transferase C-terminal-like, alpha helical domain of eukaryotic translation Elongation Factor 1 beta Back     alignment and domain information
>gnl|CDD|225003 COG2092, EFB1, Translation elongation factor EF-1beta [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|198343 cd10310, GST_C_CysRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of Cysteinyl-tRNA synthetase from higher eukaryotes Back     alignment and domain information
>gnl|CDD|198322 cd10289, GST_C_AaRS_like, Glutathione S-transferase C-terminal-like, alpha helical domain of various Aminoacyl-tRNA synthetases and similar domains Back     alignment and domain information
>gnl|CDD|198338 cd10305, GST_C_AIMP3, Glutathione S-transferase C-terminal-like, alpha helical domain of Aminoacyl tRNA synthetase complex-Interacting Multifunctional Protein 3 Back     alignment and domain information
>gnl|CDD|198339 cd10306, GST_C_GluRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of Glutamyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|198342 cd10309, GST_C_GluProRS_N, Glutathione S-transferase C-terminal-like, alpha helical domain of bifunctional Glutamyl-Prolyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|198290 cd03181, GST_C_EF1Bgamma_like, Glutathione S-transferase C-terminal-like, alpha helical domain of the Gamma subunit of Elongation Factor 1B and similar proteins Back     alignment and domain information
>gnl|CDD|215492 PLN02907, PLN02907, glutamate-tRNA ligase Back     alignment and domain information
>gnl|CDD|198291 cd03182, GST_C_GTT2_like, C-terminal, alpha helical domain of GTT2-like Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|198315 cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 226
KOG1668231 consensus Elongation factor 1 beta/delta chain [Tr 100.0
cd0029288 EF1B Elongation factor 1 beta (EF1B) guanine nucle 100.0
PRK0043588 ef1B elongation factor 1-beta; Validated 100.0
PF0073689 EF1_GNE: EF-1 guanine nucleotide exchange domain; 100.0
TIGR0048988 aEF-1_beta translation elongation factor aEF-1 bet 99.96
COG209288 EFB1 Translation elongation factor EF-1beta [Trans 99.94
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 98.98
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 98.85
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 98.8
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 98.8
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 98.79
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 98.78
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 98.78
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 98.78
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 98.77
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 98.74
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 98.72
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 98.71
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 98.71
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 98.71
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 98.69
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 98.67
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 98.66
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 98.66
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 98.64
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 98.63
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 98.63
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 98.6
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 98.59
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 98.58
PLN02473214 glutathione S-transferase 98.57
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 98.55
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 98.54
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 98.54
PLN02907 722 glutamate-tRNA ligase 98.52
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 98.51
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 98.51
PLN02395215 glutathione S-transferase 98.5
PRK10542201 glutathionine S-transferase; Provisional 98.49
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 98.48
PRK10387210 glutaredoxin 2; Provisional 98.48
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 98.48
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 98.47
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 98.46
PTZ00057205 glutathione s-transferase; Provisional 98.44
COG0625211 Gst Glutathione S-transferase [Posttranslational m 98.42
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 98.42
PRK09481211 sspA stringent starvation protein A; Provisional 98.39
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 98.38
PRK11752264 putative S-transferase; Provisional 98.35
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 98.33
PRK10357202 putative glutathione S-transferase; Provisional 98.29
PLN02378213 glutathione S-transferase DHAR1 98.28
KOG0867226 consensus Glutathione S-transferase [Posttranslati 98.27
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 98.27
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 98.23
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 98.2
PLN02817265 glutathione dehydrogenase (ascorbate) 98.11
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 98.11
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 98.0
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 97.99
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 97.94
PF1058728 EF-1_beta_acid: Eukaryotic elongation factor 1 bet 97.71
PRK15113214 glutathione S-transferase; Provisional 97.67
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 97.4
KOG2903319 consensus Predicted glutathione S-transferase [Pos 96.82
KOG1422221 consensus Intracellular Cl- channel CLIC, contains 96.77
KOG0868217 consensus Glutathione S-transferase [Posttranslati 96.75
KOG1147 712 consensus Glutamyl-tRNA synthetase [Translation, r 96.72
KOG0406231 consensus Glutathione S-transferase [Posttranslati 96.38
KOG4420325 consensus Uncharacterized conserved protein (Gangl 96.29
KOG4244281 consensus Failed axon connections (fax) protein/gl 96.07
KOG1695206 consensus Glutathione S-transferase [Posttranslati 95.59
KOG3029370 consensus Glutathione S-transferase-related protei 92.57
PF04399132 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain 92.22
KOG3027257 consensus Mitochondrial outer membrane protein Met 90.01
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub 89.14
KOG3028313 consensus Translocase of outer mitochondrial membr 84.86
PF1058728 EF-1_beta_acid: Eukaryotic elongation factor 1 bet 84.21
PF11801168 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 81.48
>KOG1668 consensus Elongation factor 1 beta/delta chain [Transcription] Back     alignment and domain information
Probab=100.00  E-value=1.3e-65  Score=444.84  Aligned_cols=222  Identities=55%  Similarity=0.868  Sum_probs=188.0

Q ss_pred             cccccCcccHHHHHHHHhhcCCCCeeecCCCCHHHHHHHchhccCC-CCCCccHHHHHHHHHhhhccc--CCCCCCCCce
Q 027200            2 AVAFDNVNSATGLKKLDEYLLTRSYITGYQASKDDITVYSALSKAP-SSEYVNVSRWYKHIDALLRIS--GVTGEGSGVT   78 (226)
Q Consensus         2 ~~~f~dl~s~~~L~~Ln~~La~rsYl~G~~~SiADIavf~~L~~~p-~~~yPnl~RWy~~I~s~p~~~--~~pg~~~~~~   78 (226)
                      +|.|+|+++..+++.||.+|++++|+.|+++|.+|+.+|.++...| ...|+|..|||++|.++....  .++|......
T Consensus         1 ~m~ftdl~~~~glk~l~~sLA~ks~~~g~~~s~edv~vf~al~~ep~s~~~v~~~~w~~~l~a~~~~~~~~~~G~~~~~~   80 (231)
T KOG1668|consen    1 PMAFTDLKSPAGLKKLNKSLAEKSYIEGYQLSKEDVVVFAALGVEPQSARLVNAERWYSKLEALLRLLAKLLAGVSKALP   80 (231)
T ss_pred             CCcccccCchhhhhhhhHhhhcccCCCCCCcccccceeehhcccCcchhhhhHHHHHHHHHHHHHHHHhhcccccccccc
Confidence            4899999999999999999999999999999999999999998777 469999999999999987632  4555444433


Q ss_pred             ecCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcHHHHH----HHHHHHHHHHhhhcc--cccccceeEEEeecCCCccc
Q 027200           79 VEGSAPVATPPVADSKATAPDDDDDDVDLFGEETEEEKK----AAEARAASVKASAKK--KESGKSSVLLDVKPWDDETD  152 (226)
Q Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~ddd~dlfg~~~ee~~~----~~~~~~~~~~~~~~~--~~~~Ks~v~l~vkP~d~etd  152 (226)
                      ..+++..++|++.+++++++.+||||+||||||+||+++    .+++|.++|++++.+  .+++||+|+|+|||||+|||
T Consensus        81 ~~~~~~~a~~~~~~~a~~ae~dddDDiDLFGsd~EEEd~eA~~~~eErla~y~~kka~k~~~iakssvlLdvkpwddeTd  160 (231)
T KOG1668|consen   81 AHGAPSVAAPPAVEAAAAAEADDDDDVDLFGSDDEEEDEEAARIREERLAAYAAKKAKKPPPIAKSSVLLDVKPWDDETD  160 (231)
T ss_pred             cCCCCcCCCCccccccccccccccccccccCCccccchhHHHHHHhhhhhhhhHHhccCCcccccceEEeecCCcCCCCC
Confidence            333332223232333555667899999999998776543    456677777765443  35999999999999999999


Q ss_pred             HHHHHHHHhhhccCCceEeeeeeeeeeeeeeeEEEEEEEeCCCCChhHHHhhhhcccccCCCcceeeeeeeccC
Q 027200          153 MKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI  226 (226)
Q Consensus       153 l~~l~~~vr~i~~~gl~wg~~k~~pv~fGikkLqi~~vv~Dd~v~~d~l~e~~~~~~~~e~~VqS~di~~~~k~  226 (226)
                      |.+|+++||+|+|+||+||++|++|||||||||||+|||+||+||+|.|+|+   |..+|++||||||++||||
T Consensus       161 m~~~e~~vrsi~~~gl~wgasklvpvGygikKlqi~~vveddkvs~D~l~e~---i~~~e~~Vqs~di~afnki  231 (231)
T KOG1668|consen  161 MKELEECVRSIEMDGLVWGASKLVPVGYGIKKLQIQCVVEDDKVSIDDLIEE---ITKFEDHVQSVDIAAFNKI  231 (231)
T ss_pred             HHHHHHHHHHhhhccceeccccccccccceeeEEEEEEEEcCccccchhHHH---hhhhhcceeeehhhhcccC
Confidence            9999999999999999999999999999999999999999999999999999   7889999999999999997



>cd00292 EF1B Elongation factor 1 beta (EF1B) guanine nucleotide exchange domain Back     alignment and domain information
>PRK00435 ef1B elongation factor 1-beta; Validated Back     alignment and domain information
>PF00736 EF1_GNE: EF-1 guanine nucleotide exchange domain; InterPro: IPR014038 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>TIGR00489 aEF-1_beta translation elongation factor aEF-1 beta Back     alignment and domain information
>COG2092 EFB1 Translation elongation factor EF-1beta [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>PF10587 EF-1_beta_acid: Eukaryotic elongation factor 1 beta central acidic region; InterPro: IPR018940 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2903 consensus Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1422 consensus Intracellular Cl- channel CLIC, contains GST domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0868 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1147 consensus Glutamyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown] Back     alignment and domain information
>KOG4244 consensus Failed axon connections (fax) protein/glutathione S-transferase-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1695 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3029 consensus Glutathione S-transferase-related protein [General function prediction only] Back     alignment and domain information
>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG3027 consensus Mitochondrial outer membrane protein Metaxin 2, Metaxin 1-binding protein [Cell wall/membrane/envelope biogenesis; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>KOG3028 consensus Translocase of outer mitochondrial membrane complex, subunit TOM37/Metaxin 1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10587 EF-1_beta_acid: Eukaryotic elongation factor 1 beta central acidic region; InterPro: IPR018940 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ] Back     alignment and domain information
>PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
1b64_A91 Solution Structure Of The Guanine Nucleotide Exchan 2e-25
1f60_B94 Crystal Structure Of The Yeast Elongation Factor Co 5e-18
1ije_B90 Nucleotide Exchange Intermediates In The Eef1a-eef1 6e-18
2b7b_B94 Yeast Guanine Nucleotide Exchange Factor Eef1balpha 3e-17
>pdb|1B64|A Chain A, Solution Structure Of The Guanine Nucleotide Exchange Factor Domain From Human Elongation Factor-One Beta, Nmr, 20 Structures Length = 91 Back     alignment and structure

Iteration: 1

Score = 112 bits (280), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 55/87 (63%), Positives = 66/87 (75%), Gaps = 3/87 (3%) Query: 140 VLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVD 199 +LLDVKPWDDETDM KLEE VRS+Q +GL+WG+SKL PVGYGIKKLQI + DD V D Sbjct: 8 ILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTD 67 Query: 200 TLIEEHLLEEPINEYVQSCDIVAFNKI 226 ++EE + +YVQS D+ AFNKI Sbjct: 68 -MLEEQIT--AFEDYVQSMDVAAFNKI 91
>pdb|1F60|B Chain B, Crystal Structure Of The Yeast Elongation Factor Complex Eef1a:eef1ba Length = 94 Back     alignment and structure
>pdb|1IJE|B Chain B, Nucleotide Exchange Intermediates In The Eef1a-eef1ba Complex Length = 90 Back     alignment and structure
>pdb|2B7B|B Chain B, Yeast Guanine Nucleotide Exchange Factor Eef1balpha K205a Mutant In Complex With Eef1a And Gdp Length = 94 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
1f60_B94 Elongation factor EEF1BA; protein-protein complex, 4e-45
1b64_A91 Elongation factor 1-beta; guanine nucleotide excha 1e-41
1gh8_A89 Translation elongation factor 1BETA; alpha-beta sa 1e-22
2yy3_A91 Elongation factor 1-beta; structural genomics, NPP 2e-14
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 5e-12
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 6e-08
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 3e-04
>1f60_B Elongation factor EEF1BA; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: d.58.12.1 PDB: 1g7c_B* 2b7c_B 2b7b_B 1ije_B* 1ijf_B* Length = 94 Back     alignment and structure
 Score =  144 bits (366), Expect = 4e-45
 Identities = 45/96 (46%), Positives = 64/96 (66%), Gaps = 3/96 (3%)

Query: 131 KKKESGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLT 190
             K + KS V LDVKPWDDET+++++   V++++MEGL WGA +  P+G+GIKKLQI   
Sbjct: 2   PAKPAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCV 61

Query: 191 IVDDLVSVDTLIEEHLLEEPINEYVQSCDIVAFNKI 226
           + DD VS+D L +     E   ++VQS DI A  K+
Sbjct: 62  VEDDKVSLDDLQQS---IEEDEDHVQSTDIAAMQKL 94


>1b64_A Elongation factor 1-beta; guanine nucleotide exchange factor, G-protein, translation elongation; NMR {Homo sapiens} SCOP: d.58.12.1 Length = 91 Back     alignment and structure
>1gh8_A Translation elongation factor 1BETA; alpha-beta sandwich, gene regulation, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus} SCOP: d.58.12.1 Length = 89 Back     alignment and structure
>2yy3_A Elongation factor 1-beta; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 2.50A {Pyrococcus horikoshii} Length = 91 Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Length = 209 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
1f60_B94 Elongation factor EEF1BA; protein-protein complex, 100.0
1b64_A91 Elongation factor 1-beta; guanine nucleotide excha 100.0
1gh8_A89 Translation elongation factor 1BETA; alpha-beta sa 100.0
2yy3_A91 Elongation factor 1-beta; structural genomics, NPP 100.0
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 99.2
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 98.93
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 98.86
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 98.85
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 98.84
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 98.81
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 98.78
4gci_A211 Glutathione S-transferase; GST, enzyme function in 98.77
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 98.75
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 98.74
4glt_A225 Glutathione S-transferase-like protein; structural 98.73
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 98.73
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 98.73
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 98.73
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 98.73
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 98.72
3lyp_A215 Stringent starvation protein A; structural genomic 98.72
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 98.72
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 98.72
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 98.72
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 98.71
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 98.71
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 98.71
1f2e_A201 Glutathione S-transferase; GST complexed with glut 98.71
1r5a_A218 Glutathione transferase; glutathione S-transferase 98.71
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 98.69
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 98.69
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 98.69
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 98.68
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 98.68
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 98.67
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 98.67
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 98.67
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 98.66
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 98.65
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 98.65
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 98.64
3lxz_A229 Glutathione S-transferase family protein; structur 98.64
3niv_A222 Glutathione S-transferase; structural genomics, PS 98.64
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 98.63
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 98.63
2fhe_A216 GST, glutathione S-transferase; transferase-substr 98.63
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 98.62
4ikh_A244 Glutathione S-transferase; enzyme function initiat 98.62
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 98.62
3n5o_A235 Glutathione transferase; seattle structural genomi 98.61
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 98.61
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 98.61
1axd_A209 Glutathione S-transferase I; transferase, herbicid 98.6
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 98.6
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 98.6
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 98.59
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 98.59
4exj_A238 Uncharacterized protein; transferase-like protein, 98.59
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 98.59
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 98.58
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 98.58
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 98.58
3lyk_A216 Stringent starvation protein A homolog; structural 98.58
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 98.57
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 98.57
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 98.57
3tou_A226 Glutathione S-transferase protein; GSH binding sit 98.57
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 98.57
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 98.56
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 98.56
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 98.56
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 98.55
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 98.55
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 98.55
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 98.55
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 98.55
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 98.55
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 98.53
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 98.53
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 98.52
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 98.51
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 98.51
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 98.51
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 98.5
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 98.5
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 98.5
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 98.5
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 98.49
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 98.49
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 98.49
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 98.48
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 98.48
4dej_A231 Glutathione S-transferase related protein; transfe 98.47
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 98.46
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 98.46
4ecj_A244 Glutathione S-transferase; transferase-like protei 98.46
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 98.46
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 98.46
2r4v_A247 XAP121, chloride intracellular channel protein 2; 98.44
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 98.43
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 98.42
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 98.42
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 98.41
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 98.41
2ahe_A267 Chloride intracellular channel protein 4; glutathi 98.39
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 98.37
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 98.35
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 98.33
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 98.3
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 98.29
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 98.27
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 98.21
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 98.17
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 98.13
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 98.01
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 97.96
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 97.78
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 97.25
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 93.17
3bpd_A100 Uncharacterized protein; heptamer, Mg+2 ION, PSI-2 82.76
>1f60_B Elongation factor EEF1BA; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: d.58.12.1 PDB: 1g7c_B* 2b7c_B 2b7b_B 1ije_B* 1ijf_B* Back     alignment and structure
Probab=100.00  E-value=1.1e-40  Score=254.54  Aligned_cols=92  Identities=49%  Similarity=0.802  Sum_probs=88.7

Q ss_pred             ccccccceeEEEeecCCCcccHHHHHHHHhhhccCCceEeeeeeeeeeeeeeeEEEEEEEeCCCCChhHHHhhhhccccc
Q 027200          132 KKESGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPI  211 (226)
Q Consensus       132 ~~~~~Ks~v~l~vkP~d~etdl~~l~~~vr~i~~~gl~wg~~k~~pv~fGikkLqi~~vv~Dd~v~~d~l~e~~~~~~~~  211 (226)
                      ||+++||+++|+|||||+||||++|+++||+++|+||.||+++++|||||||||||+|+|+|++||||+|+|+   |++|
T Consensus         3 ~k~~~ks~v~l~VkP~d~etDl~~L~~~Vr~i~~~Gl~wg~~k~~piafGlkkL~i~~vveDd~~~tD~lee~---i~~~   79 (94)
T 1f60_B            3 AKPAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQS---IEED   79 (94)
T ss_dssp             --CCCEEEEEEEEEESSTTSCHHHHHHHHHTCCCTTEEEEEEEEEEEETTEEEEEEEEEEETTTCCHHHHHHH---HHTC
T ss_pred             CCceeeEEEEEEEccCCCCcCHHHHHHHHHHhCcCCcEEEEEEEEEEeeeeEEEEEEEEEECCccChHHHHHH---HHhc
Confidence            4679999999999999999999999999999999999999999999999999999999999999999999999   8999


Q ss_pred             CCCcceeeeeeeccC
Q 027200          212 NEYVQSCDIVAFNKI  226 (226)
Q Consensus       212 e~~VqS~di~~~~k~  226 (226)
                      |++||||||++||||
T Consensus        80 ed~VqSvdI~~~~ki   94 (94)
T 1f60_B           80 EDHVQSTDIAAMQKL   94 (94)
T ss_dssp             TTTEEEEEEEEEEEC
T ss_pred             cCceeEEEEEEEEcC
Confidence            999999999999997



>1b64_A Elongation factor 1-beta; guanine nucleotide exchange factor, G-protein, translation elongation; NMR {Homo sapiens} SCOP: d.58.12.1 Back     alignment and structure
>1gh8_A Translation elongation factor 1BETA; alpha-beta sandwich, gene regulation, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus} SCOP: d.58.12.1 Back     alignment and structure
>2yy3_A Elongation factor 1-beta; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 2.50A {Pyrococcus horikoshii} Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bpd_A Uncharacterized protein; heptamer, Mg+2 ION, PSI-2, NYSGXRC, structural genom protein structure initiative; 2.80A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.61.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 226
d1f60b_90 d.58.12.1 (B:) Guanine nucleotide exchange factor 9e-41
d1b64a_91 d.58.12.1 (A:) Guanine nucleotide exchange factor 4e-39
d1gh8a_89 d.58.12.1 (A:) aEF-1beta {Archaeon Methanobacteriu 9e-32
d2hrkb1118 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, 1e-05
>d1f60b_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 90 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: eEF-1beta-like
family: eEF-1beta-like
domain: Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  132 bits (334), Expect = 9e-41
 Identities = 44/90 (48%), Positives = 62/90 (68%), Gaps = 3/90 (3%)

Query: 137 KSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLV 196
           KS V LDVKPWDDET+++++   V++++MEGL WGA +  P+G+GIKKLQI   + DD V
Sbjct: 4   KSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKV 63

Query: 197 SVDTLIEEHLLEEPINEYVQSCDIVAFNKI 226
           S+D L +     E   ++VQS DI A  K+
Sbjct: 64  SLDDLQQS---IEEDEDHVQSTDIAAMQKL 90


>d1b64a_ d.58.12.1 (A:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1gh8a_ d.58.12.1 (A:) aEF-1beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 89 Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
d1f60b_90 Guanine nucleotide exchange factor (GEF) domain fr 100.0
d1b64a_91 Guanine nucleotide exchange factor (GEF) domain fr 100.0
d1gh8a_89 aEF-1beta {Archaeon Methanobacterium thermoautotro 100.0
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 99.18
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.17
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.11
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.09
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.06
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 98.99
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 98.99
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 98.98
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 98.97
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 98.97
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 98.96
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 98.92
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 98.92
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 98.89
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 98.87
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 98.86
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 98.81
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 98.8
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 98.79
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 98.74
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 98.73
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 98.71
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 98.71
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 98.7
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 98.67
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 98.65
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 98.65
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 98.61
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 98.61
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 98.61
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 98.6
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 98.55
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 98.41
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 98.38
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 98.34
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 98.02
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 97.93
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 89.8
>d1f60b_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: eEF-1beta-like
family: eEF-1beta-like
domain: Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=3.1e-39  Score=243.05  Aligned_cols=90  Identities=49%  Similarity=0.809  Sum_probs=88.3

Q ss_pred             ccccceeEEEeecCCCcccHHHHHHHHhhhccCCceEeeeeeeeeeeeeeeEEEEEEEeCCCCChhHHHhhhhcccccCC
Q 027200          134 ESGKSSVLLDVKPWDDETDMKKLEEAVRSVQMEGLLWGASKLAPVGYGIKKLQIMLTIVDDLVSVDTLIEEHLLEEPINE  213 (226)
Q Consensus       134 ~~~Ks~v~l~vkP~d~etdl~~l~~~vr~i~~~gl~wg~~k~~pv~fGikkLqi~~vv~Dd~v~~d~l~e~~~~~~~~e~  213 (226)
                      |+|||+++|+|||||+||||++|+++||+++++|+.||+++++||||||||||++|+|+|++||||+|+|+   ++++|+
T Consensus         1 p~aKs~vvl~VkP~d~e~Dl~~l~~~ik~i~~~gl~~g~~~~~PiafGlkkL~i~~vveDd~~~~D~lee~---i~~~Ed   77 (90)
T d1f60b_           1 PAAKSIVTLDVKPWDDETNLEEMVANVKAIEMEGLTWGAHQFIPIGFGIKKLQINCVVEDDKVSLDDLQQS---IEEDED   77 (90)
T ss_dssp             CCCEEEEEEEEEESSTTSCHHHHHHHHHTCCCTTEEEEEEEEEEEETTEEEEEEEEEEETTTCCHHHHHHH---HHTCTT
T ss_pred             CcceEEEEEEEeeCCCCCCHHHHHHHHHHhCcCccEEeEEEEEEEeeeeeeEEEEEEEEeCCcCHHHHHHH---HHhhcC
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999   889999


Q ss_pred             CcceeeeeeeccC
Q 027200          214 YVQSCDIVAFNKI  226 (226)
Q Consensus       214 ~VqS~di~~~~k~  226 (226)
                      +||||||++||||
T Consensus        78 ~VqSvdI~~~~ki   90 (90)
T d1f60b_          78 HVQSTDIAAMQKL   90 (90)
T ss_dssp             TEEEEEEEEEEEC
T ss_pred             ceeEEEEEEEecC
Confidence            9999999999997



>d1b64a_ d.58.12.1 (A:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh8a_ d.58.12.1 (A:) aEF-1beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure