Citrus Sinensis ID: 027253


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MNKMDDFYFYIMTIIATSVAIFLIRLLHVLYLTGKSRRLKSPQPLSTLIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGCLM
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccccHHHHHHHHHHHccccccccCEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHccccEEEEEEEEEcccccccccHHHHHHcccccEEEEEcHHHHHHccccEEEEEcc
****DDFYFYIMTIIATSVAIFLIRLLHVLYLTGKSRRL***QPLSTLIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGCLM
xxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKMDDFYFYIMTIIATSVAIFLIRLLHVLYLTGKSRRLKSPQPLSTLIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGCLM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UDP-N-acetylglucosamine transferase subunit ALG14 homolog Involved in protein N-glycosylation. Essential for the second step of the dolichol-linked oligosaccharide pathway. Anchors the catalytic subunit ALG13 to the ER.probableQ6AY85
UDP-N-acetylglucosamine transferase subunit alg14 Involved in protein N-glycosylation. Essential for the second step of the dolichol-linked oligosaccharide pathway. Anchors the catalytic subunit alg13 to the ER.probableO14199
UDP-N-acetylglucosamine transferase subunit ALG14 homolog Involved in protein N-glycosylation. Essential for the second step of the dolichol-linked oligosaccharide pathway. Anchors the catalytic subunit ALG13 to the ER.probableQ9D081

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S2U, chain A
Confidence level:confident
Coverage over the Query: 45-114,126-225
View the alignment between query and template
View the model in PyMOL
Template: 3FRO, chain A
Confidence level:probable
Coverage over the Query: 43-214
View the alignment between query and template
View the model in PyMOL