Citrus Sinensis ID: 027253

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MNKMDDFYFYIMTIIATSVAIFLIRLLHVLYLTGKSRRLKSPQPLSTLIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGCLM
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccccHHHHHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHccccEEEEEEEEEcccccccccHHHHHHcccccEEEEEcHHHHHHccccEEEEEcc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccccHHHHHHHHHHHccHccccccEEEEEcccccHHHHHHHHHHHHccccccccccEEEEEEccccHccccHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEEEEEEcccccccEEEEEccHHcEEEEEcHHHHHHccccEEEEEEc
MNKMDDFYFYIMTIIATSVAIFLIRLLHVLYLTgksrrlkspqplstLIVLGSGGHTAEMMNLLSVLqmdrftprFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPqvvlcngpgtcipLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADqffvqwpqlqrkyprahyvgclm
MNKMDDFYFYIMTIIATSVAIFLIRLLHVLYLTGksrrlkspqplSTLIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADQFFvqwpqlqrkyprahYVGCLM
MNKMDDFYFYIMTIIATSVAIFLIRLLHVLYLTGKSRRLKSPQPLSTLIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVwttllatthalwlMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRlslsglllyklCIADQFFVQWPQLQRKYPRAHYVGCLM
*****DFYFYIMTIIATSVAIFLIRLLHVLYLTGKSRRL***QPLSTLIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGC**
****DDFYFYIMTIIATSVAIFLIRLLHV******************LIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLH***IKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGCLM
MNKMDDFYFYIMTIIATSVAIFLIRLLHVLYLTGKSRRLKSPQPLSTLIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGCLM
*NKMDDFYFYIMTIIATSVAIFLIRLLHVLYLTGKSRRLKSPQPLSTLIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGCLM
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKMDDFYFYIMTIIATSVAIFLIRLLHVLYLTGKSRRLKSPQPLSTLIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGCLM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query226 2.2.26 [Sep-21-2011]
Q6CF02216 UDP-N-acetylglucosamine t yes no 0.765 0.800 0.452 2e-38
Q6AY85216 UDP-N-acetylglucosamine t yes no 0.889 0.930 0.438 7e-38
Q96F25216 UDP-N-acetylglucosamine t yes no 0.769 0.805 0.446 4e-37
Q9D081217 UDP-N-acetylglucosamine t yes no 0.915 0.953 0.400 8e-37
Q5A5N6219 UDP-N-acetylglucosamine t N/A no 0.907 0.936 0.429 5e-35
O14199210 UDP-N-acetylglucosamine t yes no 0.871 0.938 0.380 3e-32
Q6BMD0232 UDP-N-acetylglucosamine t yes no 0.769 0.75 0.413 6e-32
P0CM10229 UDP-N-acetylglucosamine t yes no 0.699 0.689 0.395 1e-22
P0CM11229 UDP-N-acetylglucosamine t N/A no 0.699 0.689 0.395 1e-22
Q6FV75242 UDP-N-acetylglucosamine t yes no 0.774 0.723 0.368 6e-21
>sp|Q6CF02|ALG14_YARLI UDP-N-acetylglucosamine transferase subunit ALG14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ALG14 PE=3 SV=1 Back     alignment and function desciption
 Score =  159 bits (401), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 118/179 (65%), Gaps = 6/179 (3%)

Query: 48  LIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSS 107
           ++++GSGGHT EM+ +L  L++  +  R Y++++ D  SL+K +V E +   K  IK  +
Sbjct: 44  MVMMGSGGHTGEMLRMLKTLKLQSYAKRVYVSSSGDVDSLEKVKVLESTT--KTDIK--T 99

Query: 108 AQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLF 167
                I R+R+VGQSY +SV T+ ++   A+ L+ K +P V++CNGP TC+ LC  AFL 
Sbjct: 100 MVLENIPRARKVGQSYPSSVITSAVSFAVAVKLVHKHKPHVIVCNGPATCVMLCYAAFLL 159

Query: 168 KVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGCLM 226
           + + +  + I YVES+ARV RLSLSGL+L   C  D+F VQWPQL  KYPRA Y G L+
Sbjct: 160 RFMALIDTRIIYVESLARVNRLSLSGLILLPFC--DRFLVQWPQLAEKYPRAEYHGILV 216
Involved in protein N-glycosylation. Essential for the second step of the dolichol-linked oligosaccharide pathway.
Yarrowia lipolytica (strain CLIB 122 / E 150) (taxid: 284591)
>sp|Q6AY85|ALG14_RAT UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Rattus norvegicus GN=Alg14 PE=2 SV=1 Back     alignment and function description
>sp|Q96F25|ALG14_HUMAN UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Homo sapiens GN=ALG14 PE=2 SV=1 Back     alignment and function description
>sp|Q9D081|ALG14_MOUSE UDP-N-acetylglucosamine transferase subunit ALG14 homolog OS=Mus musculus GN=Alg14 PE=2 SV=1 Back     alignment and function description
>sp|Q5A5N6|ALG14_CANAL UDP-N-acetylglucosamine transferase subunit ALG14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ALG14 PE=3 SV=1 Back     alignment and function description
>sp|O14199|ALG14_SCHPO UDP-N-acetylglucosamine transferase subunit alg14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg14 PE=3 SV=1 Back     alignment and function description
>sp|Q6BMD0|ALG14_DEBHA UDP-N-acetylglucosamine transferase subunit ALG14 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ALG14 PE=3 SV=2 Back     alignment and function description
>sp|P0CM10|ALG14_CRYNJ UDP-N-acetylglucosamine transferase subunit ALG14 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ALG14 PE=3 SV=1 Back     alignment and function description
>sp|P0CM11|ALG14_CRYNB UDP-N-acetylglucosamine transferase subunit ALG14 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ALG14 PE=3 SV=1 Back     alignment and function description
>sp|Q6FV75|ALG14_CANGA UDP-N-acetylglucosamine transferase subunit ALG14 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ALG14 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
297800244233 hypothetical protein ARALYDRAFT_493043 [ 0.964 0.935 0.738 5e-92
449462031222 PREDICTED: UDP-N-acetylglucosamine trans 0.951 0.968 0.760 4e-91
224059925233 predicted protein [Populus trichocarpa] 0.995 0.965 0.705 6e-89
77416981233 unknown [Solanum tuberosum] 0.986 0.957 0.695 3e-87
255635606233 unknown [Glycine max] 1.0 0.969 0.678 1e-85
359483837235 PREDICTED: UDP-N-acetylglucosamine trans 1.0 0.961 0.706 4e-85
30684334233 beta-1,4-N-acetylglucosaminyltransferase 0.902 0.875 0.789 5e-84
297740650233 unnamed protein product [Vitis vinifera] 1.0 0.969 0.699 7e-83
356519078233 PREDICTED: UDP-N-acetylglucosamine trans 1.0 0.969 0.682 3e-79
356529730312 PREDICTED: UDP-N-acetylglucosamine trans 0.920 0.666 0.727 8e-79
>gi|297800244|ref|XP_002868006.1| hypothetical protein ARALYDRAFT_493043 [Arabidopsis lyrata subsp. lyrata] gi|297313842|gb|EFH44265.1| hypothetical protein ARALYDRAFT_493043 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  342 bits (878), Expect = 5e-92,   Method: Compositional matrix adjust.
 Identities = 161/218 (73%), Positives = 189/218 (86%)

Query: 9   FYIMTIIATSVAIFLIRLLHVLYLTGKSRRLKSPQPLSTLIVLGSGGHTAEMMNLLSVLQ 68
           F I  ++  ++ + ++R+L+V+Y  GK       Q  +TLIVLGSGGHTAEM++LLSVL+
Sbjct: 16  FSIGLLMILAIVLLMVRVLYVIYRCGKPLPKGVSQSFTTLIVLGSGGHTAEMLSLLSVLR 75

Query: 69  MDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVW 128
            DRFTPRFYIAAATDNMSLQKAR FEDS+  K  +K +S+QFMQIYRSREVGQSYVTSVW
Sbjct: 76  KDRFTPRFYIAAATDNMSLQKARSFEDSVAEKPAVKEASSQFMQIYRSREVGQSYVTSVW 135

Query: 129 TTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKR 188
           TT++A  HALWLM++IRPQV+LCNGPGTCIPLCVIAF+FKV+GIRWSSIFYVES+ARVK+
Sbjct: 136 TTIVAIVHALWLMIRIRPQVILCNGPGTCIPLCVIAFVFKVLGIRWSSIFYVESVARVKK 195

Query: 189 LSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGCLM 226
           LSLSG+LLYKL IADQFFVQWPQLQ KYPRAHYVGCLM
Sbjct: 196 LSLSGVLLYKLRIADQFFVQWPQLQNKYPRAHYVGCLM 233

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449462031|ref|XP_004148745.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 homolog isoform 1 [Cucumis sativus] gi|449462033|ref|XP_004148746.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 homolog isoform 2 [Cucumis sativus] gi|449516033|ref|XP_004165052.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 homolog isoform 1 [Cucumis sativus] gi|449516035|ref|XP_004165053.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 homolog isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224059925|ref|XP_002300014.1| predicted protein [Populus trichocarpa] gi|222847272|gb|EEE84819.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|77416981|gb|ABA81886.1| unknown [Solanum tuberosum] Back     alignment and taxonomy information
>gi|255635606|gb|ACU18153.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359483837|ref|XP_002274574.2| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 homolog [Vitis vinifera] Back     alignment and taxonomy information
>gi|30684334|ref|NP_193557.2| beta-1,4-N-acetylglucosaminyltransferase [Arabidopsis thaliana] gi|29824411|gb|AAP04165.1| unknown protein [Arabidopsis thaliana] gi|30793785|gb|AAP40345.1| unknown protein [Arabidopsis thaliana] gi|110737161|dbj|BAF00530.1| hypothetical protein [Arabidopsis thaliana] gi|332658614|gb|AEE84014.1| beta-1,4-N-acetylglucosaminyltransferase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297740650|emb|CBI30832.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356519078|ref|XP_003528201.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 homolog [Glycine max] Back     alignment and taxonomy information
>gi|356529730|ref|XP_003533441.1| PREDICTED: UDP-N-acetylglucosamine transferase subunit ALG14 homolog [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query226
TAIR|locus:2141926233 AT4G18230 "AT4G18230" [Arabido 0.964 0.935 0.660 1.7e-73
CGD|CAL0004350219 orf19.5363 [Candida albicans ( 0.915 0.945 0.384 7.4e-34
ZFIN|ZDB-GENE-041010-195219 alg14 "asparagine-linked glyco 0.938 0.968 0.391 4.1e-33
UNIPROTKB|Q96F25216 ALG14 "UDP-N-acetylglucosamine 0.915 0.958 0.369 1.6e-31
RGD|1312003216 Alg14 "ALG14, UDP-N-acetylgluc 0.911 0.953 0.377 6.9e-31
MGI|MGI:1914039217 Alg14 "asparagine-linked glyco 0.915 0.953 0.353 3e-30
POMBASE|SPAC5D6.06c210 alg14 "UDP-GlcNAc transferase 0.889 0.957 0.354 6.6e-26
DICTYBASE|DDB_G0290339398 ugt1 "putative glycosyltransfe 0.761 0.432 0.365 4.2e-24
WB|WBGene00019725279 hpo-16 [Caenorhabditis elegans 0.769 0.623 0.351 6.1e-23
FB|FBgn0030645191 CG6308 [Drosophila melanogaste 0.730 0.863 0.356 4.3e-22
TAIR|locus:2141926 AT4G18230 "AT4G18230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 742 (266.3 bits), Expect = 1.7e-73, P = 1.7e-73
 Identities = 144/218 (66%), Positives = 168/218 (77%)

Query:     9 FYIMTIIATSVAIFLIRLLHVLYLTGKSRRLKSPQPLSTLIVLGSGGHTAEMMNLLSVLQ 68
             F I  +I  ++ + ++R+L+V+Y  GK     + Q  +TLIVLGSGGHTAEM++LLSVL+
Sbjct:    16 FSIGLLIILAIVLLMVRVLYVIYRCGKPLPKGASQSFTTLIVLGSGGHTAEMLSLLSVLR 75

Query:    69 MDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVX 128
              DRFTPRFYIAAATDNMSLQKAR FEDSL  K  +K +S+QFMQIYRSREVGQSYVTSV 
Sbjct:    76 KDRFTPRFYIAAATDNMSLQKARSFEDSLAEKPAVKEASSQFMQIYRSREVGQSYVTSVW 135

Query:   129 XXXXXXXXXXXXMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKR 188
                         M++IRPQV+LCNGPGTCIPLCVIAFLFKV+GIRWSSIFYVES+ARVK+
Sbjct:   136 TTIVAILHALWLMIRIRPQVILCNGPGTCIPLCVIAFLFKVLGIRWSSIFYVESVARVKK 195

Query:   189 XXXXXXXXXXXCIADQFFVQWPQLQRKYPRAHYVGCLM 226
                         IADQFFVQWPQL +KYPRAHYVGCLM
Sbjct:   196 LSLSGLLLYKLRIADQFFVQWPQLHKKYPRAHYVGCLM 233
GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
CGD|CAL0004350 orf19.5363 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-195 alg14 "asparagine-linked glycosylation 14 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q96F25 ALG14 "UDP-N-acetylglucosamine transferase subunit ALG14 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1312003 Alg14 "ALG14, UDP-N-acetylglucosaminyltransferase subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1914039 Alg14 "asparagine-linked glycosylation 14" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
POMBASE|SPAC5D6.06c alg14 "UDP-GlcNAc transferase associated protein Alg14 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290339 ugt1 "putative glycosyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00019725 hpo-16 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0030645 CG6308 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O14199ALG14_SCHPONo assigned EC number0.38000.87160.9380yesno
Q6AY85ALG14_RATNo assigned EC number0.43800.88930.9305yesno
Q9D081ALG14_MOUSENo assigned EC number0.40090.91590.9539yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh2_kg.7__2476__AT4G18230.1
annotation not avaliable (233 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
scaffold_702792.1
annotation not avaliable (175 aa)
    ••• 0.777
fgenesh2_kg.4__2286__AT2G41490.1
annotation not avaliable (431 aa)
    ••• 0.509
scaffold_502884.1
annotation not avaliable (426 aa)
    ••• 0.503

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
pfam08660166 pfam08660, Alg14, Oligosaccharide biosynthesis pro 8e-78
COG0707 357 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acety 0.004
>gnl|CDD|219958 pfam08660, Alg14, Oligosaccharide biosynthesis protein Alg14 like Back     alignment and domain information 
 Score =  230 bits (590), Expect = 8e-78
 Identities = 91/179 (50%), Positives = 117/179 (65%), Gaps = 13/179 (7%)

Query: 47  TLIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGS 106
             +VLGSGGHTAEM+ LL  L  +   PR Y+   TD  SL KA  FE S          
Sbjct: 1   ICVVLGSGGHTAEMLRLLPFL-KNLEDPRRYVVTETDKDSLSKASKFEKS---------- 49

Query: 107 SAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFL 166
               ++I R+REVGQSY+ S++TTL     AL L+ + RP V+LCNGPGTC+P C+ A L
Sbjct: 50  RGGILKIPRAREVGQSYLRSIFTTLRNLLSALKLLRRERPDVILCNGPGTCVPFCLAAKL 109

Query: 167 FKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGCL 225
            K++G++ + I Y+ES ARVK LSLSG LLY L  AD+F VQWP+L++KYP+A Y G L
Sbjct: 110 LKILGLKGTKIVYIESFARVKTLSLSGKLLYPL--ADRFIVQWPELKKKYPKAIYYGRL 166

Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane. Length = 166
>gnl|CDD|223779 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 226
KOG3339211 consensus Predicted glycosyltransferase [General f 100.0
PF08660170 Alg14: Oligosaccharide biosynthesis protein Alg14 100.0
PRK12446 352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.97
COG0707 357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 99.96
TIGR00215 385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 99.79
PRK00025 380 lpxB lipid-A-disaccharide synthase; Reviewed 99.65
TIGR03492 396 conserved hypothetical protein. This protein famil 99.61
cd03785 350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 99.61
TIGR01133 348 murG undecaprenyldiphospho-muramoylpentapeptide be 99.55
PRK00726 357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.53
PF03033139 Glyco_transf_28: Glycosyltransferase family 28 N-t 99.24
TIGR00661 321 MJ1255 conserved hypothetical protein. This model 99.2
PRK13609 380 diacylglycerol glucosyltransferase; Provisional 99.0
PRK13608 391 diacylglycerol glucosyltransferase; Provisional 98.49
TIGR03568 365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 98.12
PF04007 335 DUF354: Protein of unknown function (DUF354); Inte 98.02
PF13477139 Glyco_trans_4_2: Glycosyl transferase 4-like 98.0
cd03786 363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 97.96
cd03784 401 GT1_Gtf_like This family includes the Gtfs, a grou 97.81
PRK05749 425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 97.68
TIGR00236 365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 97.63
cd03819 355 GT1_WavL_like This family is most closely related 97.54
cd03816 415 GT1_ALG1_like This family is most closely related 97.33
PLN02871 465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 97.2
cd04951 360 GT1_WbdM_like This family is most closely related 97.16
cd03808 359 GT1_cap1E_like This family is most closely related 97.14
PF13528 318 Glyco_trans_1_3: Glycosyl transferase family 1 97.03
PLN02605 382 monogalactosyldiacylglycerol synthase 97.0
TIGR01426 392 MGT glycosyltransferase, MGT family. This model de 96.87
cd03807 365 GT1_WbnK_like This family is most closely related 96.85
cd03794 394 GT1_wbuB_like This family is most closely related 96.85
cd04962 371 GT1_like_5 This family is most closely related to 96.75
PLN02275 371 transferase, transferring glycosyl groups 96.55
TIGR03088 374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 96.42
cd03820 348 GT1_amsD_like This family is most closely related 96.12
cd03801 374 GT1_YqgM_like This family is most closely related 96.09
PF13579160 Glyco_trans_4_4: Glycosyl transferase 4-like domai 96.09
cd03812 358 GT1_CapH_like This family is most closely related 96.04
COG1817 346 Uncharacterized protein conserved in archaea [Func 96.02
cd03811 353 GT1_WabH_like This family is most closely related 95.99
COG1819 406 Glycosyl transferases, related to UDP-glucuronosyl 95.9
PF04413186 Glycos_transf_N: 3-Deoxy-D-manno-octulosonic-acid 95.84
cd03823 359 GT1_ExpE7_like This family is most closely related 95.82
cd03796 398 GT1_PIG-A_like This family is most closely related 95.81
cd03800 398 GT1_Sucrose_synthase This family is most closely r 95.76
cd03806 419 GT1_ALG11_like This family is most closely related 95.66
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 95.51
PRK10307 412 putative glycosyl transferase; Provisional 95.46
PRK09922 359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 95.45
PLN02448 459 UDP-glycosyltransferase family protein 95.27
TIGR03590 279 PseG pseudaminic acid biosynthesis-associated prot 95.27
cd05844 367 GT1_like_7 Glycosyltransferases catalyze the trans 95.25
cd03802 335 GT1_AviGT4_like This family is most closely relate 95.24
PLN02949 463 transferase, transferring glycosyl groups 95.15
COG0381 383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 95.11
COG1519 419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 95.06
cd03817 374 GT1_UGDG_like This family is most closely related 94.66
cd03814 364 GT1_like_2 This family is most closely related to 94.59
cd03805 392 GT1_ALG2_like This family is most closely related 94.41
cd04955 363 GT1_like_6 This family is most closely related to 94.16
PF06925169 MGDG_synth: Monogalactosyldiacylglycerol (MGDG) sy 94.0
cd03798 377 GT1_wlbH_like This family is most closely related 93.98
cd03822 366 GT1_ecORF704_like This family is most closely rela 93.94
PLN03007 482 UDP-glucosyltransferase family protein 93.31
cd03799 355 GT1_amsK_like This is a family of GT1 glycosyltran 92.98
KOG2941 444 consensus Beta-1,4-mannosyltransferase [Posttransl 92.73
PRK10125 405 putative glycosyl transferase; Provisional 92.7
TIGR02149 388 glgA_Coryne glycogen synthase, Corynebacterium fam 91.84
PLN02210 456 UDP-glucosyl transferase 91.81
cd03821 375 GT1_Bme6_like This family is most closely related 91.58
cd01635 229 Glycosyltransferase_GTB_type Glycosyltransferases 91.51
PF13439177 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 91.5
PRK01021 608 lpxB lipid-A-disaccharide synthase; Reviewed 91.41
TIGR03449 405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 90.74
PLN00414 446 glycosyltransferase family protein 90.09
PLN02670 472 transferase, transferring glycosyl groups 89.16
PLN02208 442 glycosyltransferase family protein 88.83
cd03825 365 GT1_wcfI_like This family is most closely related 87.47
PRK06849 389 hypothetical protein; Provisional 86.84
PLN02863 477 UDP-glucoronosyl/UDP-glucosyl transferase family p 86.67
PLN02534 491 UDP-glycosyltransferase 85.24
cd03809 365 GT1_mtfB_like This family is most closely related 84.86
PRK13011286 formyltetrahydrofolate deformylase; Reviewed 84.19
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 84.11
PRK10017 426 colanic acid biosynthesis protein; Provisional 83.57
PF00551181 Formyl_trans_N: Formyl transferase; InterPro: IPR0 83.12
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 82.92
TIGR00655280 PurU formyltetrahydrofolate deformylase. This mode 82.64
PLN02992 481 coniferyl-alcohol glucosyltransferase 82.56
cd08551 370 Fe-ADH iron-containing alcohol dehydrogenases (Fe- 82.34
PRK09423 366 gldA glycerol dehydrogenase; Provisional 80.83
PLN03015 470 UDP-glucosyl transferase 80.68
TIGR00639190 PurN phosphoribosylglycinamide formyltransferase, 80.46
PLN02562 448 UDP-glycosyltransferase 80.36
PRK05647200 purN phosphoribosylglycinamide formyltransferase; 80.32
PF06258 311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 80.23
cd07766 332 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) 80.19
>KOG3339 consensus Predicted glycosyltransferase [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=5.1e-48  Score=316.36  Aligned_cols=199  Identities=50%  Similarity=0.809  Sum_probs=175.8

Q ss_pred             HHHHHHHHHHHHhhhccCCCCCCCCCCCeEEEEEecChhhHHHHHHHHHHhhhcCCCCeEEEEEcCCcchhhHHHHhhhh
Q 027253           17 TSVAIFLIRLLHVLYLTGKSRRLKSPQPLSTLIVLGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDS   96 (226)
Q Consensus        17 ~~~~~~~~r~~~~~~~~~~~~~~~~~~~~kiliv~GtGGH~~p~lal~~~l~~~~~~~~~~~~~~~d~~s~~~~~~~e~~   96 (226)
                      ..+.++++|++++..+.-++.  .++++.+++++.||||||.||+++.+.+++ .|+++.|+.+++|+||++++..+|.+
T Consensus        13 ~~~~li~~~v~~~~~~~~k~~--Pk~~s~~~lVvlGSGGHT~EMlrLl~~l~~-~y~~r~yI~a~tD~mS~~k~~~F~~~   89 (211)
T KOG3339|consen   13 YVIVLIALLVFRHTQRSTKKD--PKDKSLSTLVVLGSGGHTGEMLRLLEALQD-LYSPRSYIAADTDEMSEQKARSFELS   89 (211)
T ss_pred             HHHHHHHHHHHHHHHhccCCC--CcCCcceEEEEEcCCCcHHHHHHHHHHHHh-hcCceEEEEecCchhhHHHHHhhhcc
Confidence            456666677766655443333  223679999999999999999999999965 68889999999999999999999877


Q ss_pred             hhhhcccCCcceEEEEeecCccccchhHHHHHHHHHHHHHHHHhhHhcCCcEEEecCCCcchhHHHHHHHHHHcCCccce
Q 027253           97 LLHKKVIKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSS  176 (226)
Q Consensus        97 ~~~~~~~~~~~~~~~~i~r~r~~~~~~~~~~~~~l~~~~~a~~il~k~kPdvVi~tGg~vsvP~~lAa~lakllgi~~~~  176 (226)
                      +.+.      +...+.+||+|+++|+|+++++++++++++|+.++.|.|||+|++|||++|+|+|+++++.+++|..+..
T Consensus        90 ~a~~------~a~~~~ipRsReVgQS~ltSv~Tti~all~s~~lv~RirPdlil~NGPGTCv~i~~~a~l~~iL~~~~~~  163 (211)
T KOG3339|consen   90 LAHC------KAKNYEIPRSREVGQSWLTSVFTTIWALLQSFVLVWRIRPDLILCNGPGTCVPICLSAYLMEILGLKSSH  163 (211)
T ss_pred             cccc------chhheecchhhhhhhhhhhhHHHHHHHHHHHheEEEecCCCEEEECCCCcEeHHHHHHHHHHHhCcCceE
Confidence            6542      2345569999999999999999999999999999999999999999999999999999999999988889


Q ss_pred             EEEEccCCccCCcchhhhhhcccCCccEEEeechhhhhhCCCceEEeccC
Q 027253          177 IFYVESIARVKRLSLSGLLLYKLCIADQFFVQWPQLQRKYPRAHYVGCLM  226 (226)
Q Consensus       177 iv~~Esnarv~~~sltgKll~~~~~ad~~~vq~e~~~~~~p~a~y~G~l~  226 (226)
                      ++|+||.|||++||+|||+|  .+++|.|+||||+++++|++++|.|.++
T Consensus       164 IvyvES~cRV~tlSlsGkiL--~~~~d~Fivqw~~L~~ky~~~~~~g~iv  211 (211)
T KOG3339|consen  164 IVYVESICRVKTLSLSGKIL--YPVVDLFIVQWPALATKYLRVKYFGIIV  211 (211)
T ss_pred             EEEEeeeeEeeccccCceee--hhHHHHHHHhhHHHHHhcccceeeeecC
Confidence            99999999999999999999  7899999999999999999999999874

>PF08660 Alg14: Oligosaccharide biosynthesis protein Alg14 like; InterPro: IPR013969 Alg14 is involved dolichol-linked oligosaccharide biosynthesis and anchors the catalytic subunit Alg13 to the ER membrane [] Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>PF03033 Glyco_transf_28: Glycosyltransferase family 28 N-terminal domain; InterPro: IPR004276 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>PF13477 Glyco_trans_4_2: Glycosyl transferase 4-like Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>PF13579 Glyco_trans_4_4: Glycosyl transferase 4-like domain; PDB: 3C4Q_B 3C4V_A 3C48_B 1Z2T_A Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG1817 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PF04413 Glycos_transf_N: 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase); InterPro: IPR007507 This is a domain found in proteins that transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF06925 MGDG_synth: Monogalactosyldiacylglycerol (MGDG) synthase; InterPro: IPR009695 This entry represents a conserved region of approximately 180 residues found towirds the N terminus of a number of plant and bacterial diacylglycerol glucosyltransferases, such as monogalactosyldiacylglycerol synthase [] Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>KOG2941 consensus Beta-1,4-mannosyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PF13439 Glyco_transf_4: Glycosyltransferase Family 4; PDB: 2JJM_E 3MBO_C 2GEJ_A 2GEK_A Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>PF00551 Formyl_trans_N: Formyl transferase; InterPro: IPR002376 A number of formyl transferases belong to this group Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>cd08551 Fe-ADH iron-containing alcohol dehydrogenases (Fe-ADH)-like Back     alignment and domain information
>PRK09423 gldA glycerol dehydrogenase; Provisional Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>TIGR00639 PurN phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PRK05647 purN phosphoribosylglycinamide formyltransferase; Reviewed Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>cd07766 DHQ_Fe-ADH Dehydroquinate synthase-like (DHQ-like) and iron-containing alcohol dehydrogenases (Fe-ADH) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query226
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 39.1 bits (90), Expect = 8e-04
 Identities = 20/146 (13%), Positives = 47/146 (32%), Gaps = 39/146 (26%)

Query: 44  PLSTLIVLGSGGHTAE---MMNLL---SVLQMDRFTPRFYIAAATDNMSLQ---KARVFE 94
           P   L ++      ++   ++N L   S+++         I       S+    K ++  
Sbjct: 388 PTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISI------PSIYLELKVKLEN 441

Query: 95  DSLLHKKVIKGSSAQFMQIYRSREVGQSYVTSVWTTLLATTHAL---------------- 138
           +  LH+ ++        + + S ++   Y+   + + +   H L                
Sbjct: 442 EYALHRSIV--DHYNIPKTFDSDDLIPPYLDQYFYSHIG--HHLKNIEHPERMTLFRMVF 497

Query: 139 ----WLMVKIRPQVVLCNGPGTCIPL 160
               +L  KIR      N  G+ +  
Sbjct: 498 LDFRFLEQKIRHDSTAWNASGSILNT 523

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
3s2u_A 365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.96
1f0k_A 364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.43
3otg_A 412 CALG1; calicheamicin, TDP, structural genomics, PS 98.97
2yjn_A 441 ERYCIII, glycosyltransferase; transferase, cytochr 98.82
1rrv_A 416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 98.76
1vgv_A 384 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.74
1iir_A 415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 98.73
3dzc_A 396 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.69
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 98.61
3rsc_A 415 CALG2; TDP, enediyne, structural genomics, PSI-2, 98.55
3ot5_A 403 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.55
4amg_A 400 Snogd; transferase, polyketide biosynthesis, GT1 f 98.54
2p6p_A 384 Glycosyl transferase; X-RAY-diffraction,urdamycina 98.5
4hwg_A 385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 98.39
2iya_A 424 OLEI, oleandomycin glycosyltransferase; carbohydra 98.33
1v4v_A 376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 98.31
4fzr_A 398 SSFS6; structural genomics, PSI-biology, protein s 98.26
3ia7_A 402 CALG4; glycosysltransferase, calicheamicin, enediy 98.24
3oti_A 398 CALG3; calicheamicin, TDP, structural genomics, PS 98.23
3beo_A 375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 98.22
3tsa_A 391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 98.14
3h4t_A 404 Glycosyltransferase GTFA, glycosyltransferase; van 98.13
3c48_A 438 Predicted glycosyltransferases; retaining glycosyl 97.77
3fro_A 439 GLGA glycogen synthase; glycosyltransferase family 97.66
2acv_A 463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 97.6
2r60_A 499 Glycosyl transferase, group 1; rossmann-fold; 1.80 97.52
3okp_A 394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 97.46
2c1x_A 456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 97.29
2gek_A 406 Phosphatidylinositol mannosyltransferase (PIMA); G 97.21
2x6q_A 416 Trehalose-synthase TRET; biosynthetic protein; 2.2 96.67
2jjm_A 394 Glycosyl transferase, group 1 family protein; anth 96.55
2vch_A 480 Hydroquinone glucosyltransferase; glycosyltransfer 96.44
2iuy_A 342 Avigt4, glycosyltransferase; antibiotics, family G 96.25
2iw1_A 374 Lipopolysaccharide core biosynthesis protein RFAG; 96.24
2pq6_A 482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 95.99
1rzu_A 485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 95.64
2qzs_A 485 Glycogen synthase; glycosyl-transferase, GT-B fold 95.13
3hbf_A 454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 94.42
3oy2_A 413 Glycosyltransferase B736L; rossmann fold, GDP-mann 91.05
1psw_A 348 ADP-heptose LPS heptosyltransferase II; structural 88.15
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 87.8
1y6j_A 318 L-lactate dehydrogenase; southeast collaboratory f 86.87
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 86.47
2xci_A 374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 85.89
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 85.59
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 84.94
3o1l_A302 Formyltetrahydrofolate deformylase; structural gen 84.37
3lou_A292 Formyltetrahydrofolate deformylase; structural gen 83.32
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transfe 82.75
3auf_A229 Glycinamide ribonucleotide transformylase 1; struc 81.57
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 81.53
1jkx_A212 GART;, phosphoribosylglycinamide formyltransferase 80.88
3tqr_A215 Phosphoribosylglycinamide formyltransferase; purin 80.19
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
Probab=99.96  E-value=1.2e-28  Score=222.06  Aligned_cols=155  Identities=18%  Similarity=0.126  Sum_probs=120.5

Q ss_pred             eEEEEE-ecChhhHHHHHHHHHHhhhcCCCCeEEEEEcCCcchhhHHHHhhhhhhhhcccCCcceEEEEee---cCcccc
Q 027253           45 LSTLIV-LGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIY---RSREVG  120 (226)
Q Consensus        45 ~kiliv-~GtGGH~~p~lal~~~l~~~~~~~~~~~~~~~d~~s~~~~~~~e~~~~~~~~~~~~~~~~~~i~---r~r~~~  120 (226)
                      .||+|+ ||||||++|+++++++|+++++  ++.++++.+++|.+.+        +++|     ++++.++   .+|+..
T Consensus         3 ~~i~i~~GGTgGHi~palala~~L~~~g~--~V~~vg~~~g~e~~~v--------~~~g-----~~~~~i~~~~~~~~~~   67 (365)
T 3s2u_A            3 GNVLIMAGGTGGHVFPALACAREFQARGY--AVHWLGTPRGIENDLV--------PKAG-----LPLHLIQVSGLRGKGL   67 (365)
T ss_dssp             CEEEEECCSSHHHHHHHHHHHHHHHHTTC--EEEEEECSSSTHHHHT--------GGGT-----CCEEECC---------
T ss_pred             CcEEEEcCCCHHHHHHHHHHHHHHHhCCC--EEEEEECCchHhhchh--------hhcC-----CcEEEEECCCcCCCCH
Confidence            489999 8999999999999999998875  4677788888865544        3333     4455554   223333


Q ss_pred             chhHHHHHHHHHHHHHHHHhhHhcCCcEEEecCCCcchhHHHHHHHHHHcCCccceEEEEccCCccCCcchhhhhhcccC
Q 027253          121 QSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLC  200 (226)
Q Consensus       121 ~~~~~~~~~~l~~~~~a~~il~k~kPdvVi~tGg~vsvP~~lAa~lakllgi~~~~iv~~Esnarv~~~sltgKll~~~~  200 (226)
                      ..++.++++++++++++++++++++||+|+++|+|+|+|.++|   |+++|+   |+++||||+.   ||++||++  ++
T Consensus        68 ~~~~~~~~~~~~~~~~~~~~l~~~~PDvVi~~g~~~s~p~~la---A~~~~i---P~vihe~n~~---~G~~nr~l--~~  136 (365)
T 3s2u_A           68 KSLVKAPLELLKSLFQALRVIRQLRPVCVLGLGGYVTGPGGLA---ARLNGV---PLVIHEQNAV---AGTANRSL--AP  136 (365)
T ss_dssp             -----CHHHHHHHHHHHHHHHHHHCCSEEEECSSSTHHHHHHH---HHHTTC---CEEEEECSSS---CCHHHHHH--GG
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcCCCEEEEcCCcchHHHHHH---HHHcCC---CEEEEecchh---hhhHHHhh--cc
Confidence            5678889999999999999999999999999999999999977   688998   9999999984   99999999  88


Q ss_pred             CccEEEeechhhhhhCCCceEEecc
Q 027253          201 IADQFFVQWPQLQRKYPRAHYVGCL  225 (226)
Q Consensus       201 ~ad~~~vq~e~~~~~~p~a~y~G~l  225 (226)
                      +||.+++.|++.....++..++|+.
T Consensus       137 ~a~~v~~~~~~~~~~~~k~~~~g~p  161 (365)
T 3s2u_A          137 IARRVCEAFPDTFPASDKRLTTGNP  161 (365)
T ss_dssp             GCSEEEESSTTSSCC---CEECCCC
T ss_pred             ccceeeecccccccCcCcEEEECCC
Confidence            9999999999875544567788764
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7 Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query226
d1f0ka_ 351 Peptidoglycan biosynthesis glycosyltransferase Mur 99.65
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 98.81
d1iira_ 401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 98.41
d1rrva_ 401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 98.38
d1o6ca_ 377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 97.56
d2acva1 461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 96.72
d1f6da_ 376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 96.58
d1v4va_ 373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 96.52
d2c1xa1 450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 96.39
d2pq6a1 473 (Iso)flavonoid glycosyltransferase {Medicago trunc 93.61
d2vcha1 471 Hydroquinone glucosyltransferase {Thale cress (Ara 91.79
d2bisa1 437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 89.58
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.21
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 86.89
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 86.16
d1qfja2135 NAD(P)H:flavin oxidoreductase {Escherichia coli [T 85.61
d2piaa2120 Phthalate dioxygenase reductase {Pseudomonas cepac 84.79
d1b74a1105 Glutamate racemase {Aquifex pyrophilus [TaxId: 271 84.18
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 83.75
d1jq5a_ 366 Glycerol dehydrogenase {Bacillus stearothermophilu 82.64
d1cqxa3142 Flavohemoglobin, C-terminal domain {Alcaligenes eu 82.11
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Peptidoglycan biosynthesis glycosyltransferase MurG
domain: Peptidoglycan biosynthesis glycosyltransferase MurG
species: Escherichia coli [TaxId: 562]

Probab=99.65  E-value=1.2e-15  Score=130.25  Aligned_cols=142  Identities=18%  Similarity=0.166  Sum_probs=110.9

Q ss_pred             eEEEEE-ecChhhHHHHHHHHHHhhhcCCCCeEEEEEcCCcchhhHHHHhhhhhhhhcccCCcceEEEEeec---Ccccc
Q 027253           45 LSTLIV-LGSGGHTAEMMNLLSVLQMDRFTPRFYIAAATDNMSLQKARVFEDSLLHKKVIKGSSAQFMQIYR---SREVG  120 (226)
Q Consensus        45 ~kiliv-~GtGGH~~p~lal~~~l~~~~~~~~~~~~~~~d~~s~~~~~~~e~~~~~~~~~~~~~~~~~~i~r---~r~~~  120 (226)
                      .||+|+ ||||||+.|+++|+++|++++++  +.++++.++++...+        ++.     ++.+..++.   .++..
T Consensus         1 kkili~~~GtGGHv~~a~al~~~L~~~G~e--V~~i~~~~~~~~~~~--------~~~-----~~~~~~~~~~~~~~~~~   65 (351)
T d1f0ka_           1 KRLMVMAGGTGGHVFPGLAVAHHLMAQGWQ--VRWLGTADRMEADLV--------PKH-----GIEIDFIRISGLRGKGI   65 (351)
T ss_dssp             CEEEEECCSSHHHHHHHHHHHHHHHTTTCE--EEEEECTTSTHHHHG--------GGG-----TCEEEECCCCCCTTCCH
T ss_pred             CEEEEEcCCcHHHHHHHHHHHHHHHhCCCE--EEEEEeCCcchhhcc--------ccc-----CCcEEEEECCCcCCCCH
Confidence            378888 89999999999999999887764  666678888755444        222     244444432   23333


Q ss_pred             chhHHHHHHHHHHHHHHHHhhHhcCCcEEEecCCCcchhHHHHHHHHHHcCCccceEEEEccCCccCCcchhhhhhcccC
Q 027253          121 QSYVTSVWTTLLATTHALWLMVKIRPQVVLCNGPGTCIPLCVIAFLFKVIGIRWSSIFYVESIARVKRLSLSGLLLYKLC  200 (226)
Q Consensus       121 ~~~~~~~~~~l~~~~~a~~il~k~kPdvVi~tGg~vsvP~~lAa~lakllgi~~~~iv~~Esnarv~~~sltgKll~~~~  200 (226)
                      ...+..++.....+.....++.+++||+++++|++.+.+.+.+   ++.+++   |++.+|++..   ++.+++..  .+
T Consensus        66 ~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~---a~~~~i---p~~~~~~~~~---~~~~~~~~--~~  134 (351)
T d1f0ka_          66 KALIAAPLRIFNAWRQARAIMKAYKPDVVLGMGGYVSGPGGLA---AWSLGI---PVVLHEQNGI---AGLTNKWL--AK  134 (351)
T ss_dssp             HHHHTCHHHHHHHHHHHHHHHHHHCCSEEEECSSTTHHHHHHH---HHHTTC---CEEEEECSSS---CCHHHHHH--TT
T ss_pred             HHHHHHHHHHHHhHHHHHHHhhccccceeeecccchhhhhhhh---hhhccc---ceeecccccc---cchhHHHh--hh
Confidence            4455667777888889999999999999999999999988754   688898   9999999984   99999999  78


Q ss_pred             CccEEEeechhh
Q 027253          201 IADQFFVQWPQL  212 (226)
Q Consensus       201 ~ad~~~vq~e~~  212 (226)
                      +++.+...+...
T Consensus       135 ~~~~~~~~~~~~  146 (351)
T d1f0ka_         135 IATKVMQAFPGA  146 (351)
T ss_dssp             TCSEEEESSTTS
T ss_pred             hcceeecccccc
Confidence            999988777654
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1b74a1 c.78.2.1 (A:1-105) Glutamate racemase {Aquifex pyrophilus [TaxId: 2714]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jq5a_ e.22.1.2 (A:) Glycerol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure