Citrus Sinensis ID: 027256


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MFKFICSLKYINVAMVTVLKNVTNVITAVGEMYLFNKRHDNRVWAALFLMIISAISGGITDLSFHAVGYAWQIINCFLTASYSLTLRRVMDTAKQVTKSGNLNEFSMVLLNNSLSLPLGVLLVIVFNEVDYLSRTPLLRLPSFWLVMTLSGFLGLAISFTSMWFLHQTGATTYSLVGSLNKIPLSVAGILLFKVPTSLENSASIFFGLLAGVFFARAKMWERSQSG
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHHHECccccccHHHHHHHHHHHHHHHHHHHHcccccccc
MFKFICSLKYINVAMVTVLKNVTNVITAVGEMYLFNKRHDNRVWAALFLMIISAISGGITDLSFHAVGYAWQIINCFLTASYSLTLRRVMDTAKQVTKSGNLNEFSMVLLNNSLSLPLGVLLVIVFNEVDYLSRTPLLRLPSFWLVMTLSGFLGLAISFTSMWFLHQTGATTYSLVGSLNKIPLSVAGILLFKVPTSLENSASIFFGLLAGVFFARAKMW******
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKFICSLKYINVAMVTVLKNVTNVITAVGEMYLFNKRHDNRVWAALFLMIISAISGGITDLSFHAVGYAWQIINCFLTASYSLTLRRVMDTAKQVTKSGNLNEFSMVLLNNSLSLPLGVLLVIVFNEVDYLSRTPLLRLPSFWLVMTLSGFLGLAISFTSMWFLHQTGATTYSLVGSLNKIPLSVAGILLFKVPTSLENSASIFFGLLAGVFFARAKMWERSQSG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
GDP-mannose transporter GONST1 Involved in the import of GDP-mannose from the cytoplasm into the Golgi lumen. Required for the luminal synthesis of a variety of plant cell surface components.probableQ941R4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 151-217
View the alignment between query and template
View the model in PyMOL
Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 2-60
View the alignment between query and template
View the model in PyMOL