Citrus Sinensis ID: 027260

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220------
MASSSNNNGDILMLEAPPDAARPWNAEIIDALPYIDDDYADPRVKEEVDRMVEQEMRRSSKKPSDFLKNLPPLSKFRFENHPMLAKEYERVRAGKPPAVLDTTRYQLEILPANKRNDESAWKQALQKAQRLSQHQLIRMQRLAQEQNEKIEAVNRERKYHQQNTAYELNALSTQWRELCAKNIEIQAACANIESHIEELRKEAAESGWNLDIDMEKGFLAQSGQVH
ccccccccccEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccc
*********************RPWNAEIIDALPYIDDDYADPRVKEEVDRMV******************PPLSKFRFENHPMLAK************VLDTTRYQLEIL*************ALQKAQRLSQHQLIRMQRLAQEQNEKIEAVNRERKY**QNTAYELNALSTQWRELCAKNIEIQAACANIESHIEELRKEAAES*WN*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSNNNGDILMLEAPPDAARPWNAEIIDALPYIDDDYADPRVKEEVDRMVEQEMRRSSKKPSDFLKNLPPLSKFRFENHPMLAKEYERVRAGKPPAVLDTTRYQLEILPANKRNDESAWKQALQKAQRLSQHQxxxxxxxxxxxxxxxxxxxxxxxxxxxxTAYELNALSTQWRELCAKxxxxxxxxxxxxxxxxxxxxxAAESGWNLDIDMEKGFLAQSGQVH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pre-mRNA-splicing factor SPF27 homolog Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Involved in mRNA splicing.probableQ949S9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VMX, chain A
Confidence level:probable
Coverage over the Query: 165-208
View the alignment between query and template
View the model in PyMOL
Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 139-201
View the alignment between query and template
View the model in PyMOL