Citrus Sinensis ID: 027290

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----

MLRSVYMLMLFQLAYHLDVKAAKKAILDGFRKTDESLLQESVSGGWQDGATAVCIWILGRTVFVANIGDAKAVVARSSIVDGSNNHLDELSSLKAIVVTRVHKAIYPQERARIQKSGGTVSSNGRLQGRLEVSRAFGDRQFKKFGVVATPDIHSFEVTERDHFIILGCDGLWGVFGPSDAVEFVQKLLKEGLSVTAVSRRLVREAVLERRCKDNCTAIVIIFRHK

cHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEEccEEEEEEccccEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHcccEEEEccccccHHHHHHHccccccccccccccccEEEEEcccccEEEEEEccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccEEEEEEEccc

**RSVYMLMLFQLAYHLDVKAAKKAILDGFRKTDESLLQESVSGGWQDGATAVCIWILGRTVFVANIGDAKAVVARSSIVDGSNNHLDELSSLKAIVVTRVHKAIYPQERARIQKSGGTVSSNGRLQGRLEVSRAFGDRQFKKFGVVATPDIHSFEVTERDHFIILGCDGLWGVFGPSDAVEFVQKLLKEGLSVTAVSRRLVREAVLERRCKDNCTAIVIIFRHK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable protein phosphatase 2C 8		probable	Q9LMT1
Probable protein phosphatase 2C 67		probable	Q0J2R1

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I44, chain A
Confidence level:very confident
Coverage over the Query: 19-78,90-223
View the alignment between query and template
View the model in PyMOL