Citrus Sinensis ID: 027291


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MSKKRGLSLEEKRGKILEIFYESQDFYLLKELEKLGPKKGVITQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSCAGNQLRNVYRKLESDLQSSKKRHTELVEQCNALKKGREESDEREEALEELKAVELKHIELKDEMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMYKDVGIPEDFDYLELSPVPLSSVGDQTVEGCP
ccccccccHHHHHHHHHHHHHHccccccHHHHHHHcccccccHHcHHHHHHHHHccccccccccccCEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccc
***********KR*KILEIFYESQDFYLLKELEKLGPKKGVITQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSCAGNQLRNVYR**************************************************************AAFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMYKDVGIPEDFDYLELSPVPLS***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKKRGLSLEEKRGKILEIFYESQDFYLLKELEKLGPKKGVITQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSCAGNQLRNVxxxxxxxxxxxxxxxxxxxxxCNAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMYKDVGIPEDFDYLELSPVPLSSVGDQTVEGCP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Meiotic nuclear division protein 1 homolog Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis. Stimulates both DMC1/LIM15- and RAD51-mediated homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.confidentQ8GYD2
Meiotic nuclear division protein 1 homolog Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis. Stimulates both DMC1- and RAD51-mediated homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.probableQ32L19
Meiotic nuclear division protein 1 homolog Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination.probableQ54E86

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XUB, chain A
Confidence level:probable
Coverage over the Query: 12-59,73-181
View the alignment between query and template
View the model in PyMOL
Template: 4AIK, chain A
Confidence level:probable
Coverage over the Query: 4-88,99-137
View the alignment between query and template
View the model in PyMOL