Citrus Sinensis ID: 027291

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MSKKRGLSLEEKRGKILEIFYESQDFYLLKELEKLGPKKGVITQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSCAGNQLRNVYRKLESDLQSSKKRHTELVEQCNALKKGREESDEREEALEELKAVELKHIELKDEMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMYKDVGIPEDFDYLELSPVPLSSVGDQTVEGCP
ccccccccHHHHHHHHHHHHHHccccccHHHHHHHcccccccHHcHHHHHHHHHHcccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccc
ccccccccHHHHHHHHHHHHHcccccccHHHHHHHcHHccccHHHHHHHHHHHHccccEEEEEcccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHccccccccEEEccccccccccccEccccc
mskkrglsleEKRGKILEIFYESQDFYLLKELEklgpkkgvitQSVKDVVQSLVdddlvlkdkigtsvyfwslpscagnqLRNVYRKLESDLQSSKKRHTELVEQCNALKKGREESDEREEALEELKAVELKHIELKdemgqyadndPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMYkdvgipedfdylelspvplssvgdqtvegcp
mskkrglsleekrGKILEIFYESQDFYLLKELEKlgpkkgvitqSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSCAGNQLRNVYRKLESDlqsskkrhtelVEQCnalkkgreesdeREEALEELKAVELKHIELKDEMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMYKDVGIPEDFDYLELSpvplssvgdqtvegcp
MSKKRGLSLEEKRGKILEIFYESQDFYllkeleklgpkkgVITqsvkdvvqslvdddlvlkdkIGTSVYFWSLPSCAGNQLRNVYRKLESDLQSSKKRHTELVEQCNALkkgreesdereealeelkavelkHIELKDEMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMYKDVGIPEDFDYLELSPVPLSSVGDQTVEGCP
**************KILEIFYESQDFYLLKELEKLGPKKGVITQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSCAGNQLRNVYR**************************************************************AAFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMYKDVGIPEDFDYLEL*****************
***********KR**ILEIFYESQDFYLLKELEKLGP**GV*TQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSCAGNQLRNVYR***************************************************************AFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMYKDVGIPEDFDYLELSPVPLS***********
********LEEKRGKILEIFYESQDFYLLKELEKLGPKKGVITQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSCAGNQLRNVYRKLESDLQSSKKRHTELVEQCNAL**************EELKAVELKHIELKDEMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMYKDVGIPEDFDYLELSPVPLSS**********
*******SLEEKRGKILEIFYESQDFYLLKELEKLGPKKGVITQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSCAGNQLRNVYRKLESDLQSSKKRHTELVEQCNALKKGREESDEREEALEELKAVELKHIELKDEMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMYKDVGIPEDFDYLELSPVPLS***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKKRGLSLEEKRGKILEIFYESQDFYLLKELEKLGPKKGVITQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSCAGNQLRNVxxxxxxxxxxxxxxxxxxxxxCNAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMYKDVGIPEDFDYLELSPVPLSSVGDQTVEGCP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
Q8GYD2230 Meiotic nuclear division yes no 0.955 0.934 0.776 2e-96
Q8K396205 Meiotic nuclear division yes no 0.906 0.995 0.432 3e-42
Q9BWT6205 Meiotic nuclear division yes no 0.906 0.995 0.432 4e-42
Q32L19205 Meiotic nuclear division yes no 0.906 0.995 0.427 6e-42
Q5XGY9205 Meiotic nuclear division N/A no 0.906 0.995 0.423 6e-42
Q6DC61220 Meiotic nuclear division yes no 0.768 0.786 0.431 5e-34
Q09739210 Meiotic coiled-coil prote yes no 0.888 0.952 0.394 1e-29
Q54E86221 Meiotic nuclear division yes no 0.893 0.909 0.318 3e-18
P53102219 Meiotic nuclear division yes no 0.822 0.844 0.314 9e-11
>sp|Q8GYD2|MND1_ARATH Meiotic nuclear division protein 1 homolog OS=Arabidopsis thaliana GN=MND1 PE=1 SV=1 Back     alignment and function desciption
 Score =  351 bits (900), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 167/215 (77%), Positives = 190/215 (88%)

Query: 1   MSKKRGLSLEEKRGKILEIFYESQDFYLLKELEKLGPKKGVITQSVKDVVQSLVDDDLVL 60
           MSKKRGLSLEEKR K+L+IFYESQDF+LLKELEK+GPKKGVI+QSVKDV+QSLVDDDLV 
Sbjct: 1   MSKKRGLSLEEKREKMLQIFYESQDFFLLKELEKMGPKKGVISQSVKDVIQSLVDDDLVA 60

Query: 61  KDKIGTSVYFWSLPSCAGNQLRNVYRKLESDLQSSKKRHTELVEQCNALKKGREESDERE 120
           KDKIG S+YFWSLPSCAGNQLR+V +KLESDLQ S KR  ELV+QC ALKKGREES+ER 
Sbjct: 61  KDKIGISIYFWSLPSCAGNQLRSVRQKLESDLQGSNKRLAELVDQCEALKKGREESEERT 120

Query: 121 EALEELKAVELKHIELKDEMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCS 180
           EAL +LK +E KH +LK+EM Q+ADNDPA  EA +NAIEVAH +ANRWTDNIFTL+QWCS
Sbjct: 121 EALTQLKDIEKKHKDLKNEMVQFADNDPATLEAKRNAIEVAHQSANRWTDNIFTLRQWCS 180

Query: 181 NNFPQAKEELEQMYKDVGIPEDFDYLELSPVPLSS 215
           NNFPQAKE+LE +Y + GI EDFDY+ELS  PLSS
Sbjct: 181 NNFPQAKEQLEHLYTEAGITEDFDYIELSSFPLSS 215
Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis. Stimulates both DMC1/LIM15- and RAD51-mediated homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8K396|MND1_MOUSE Meiotic nuclear division protein 1 homolog OS=Mus musculus GN=Mnd1 PE=1 SV=1 Back     alignment and function description
>sp|Q9BWT6|MND1_HUMAN Meiotic nuclear division protein 1 homolog OS=Homo sapiens GN=MND1 PE=1 SV=1 Back     alignment and function description
>sp|Q32L19|MND1_BOVIN Meiotic nuclear division protein 1 homolog OS=Bos taurus GN=MND1 PE=2 SV=1 Back     alignment and function description
>sp|Q5XGY9|MND1_XENLA Meiotic nuclear division protein 1 homolog OS=Xenopus laevis GN=mnd1 PE=2 SV=1 Back     alignment and function description
>sp|Q6DC61|MND1_DANRE Meiotic nuclear division protein 1 homolog OS=Danio rerio GN=mnd1 PE=2 SV=1 Back     alignment and function description
>sp|Q09739|MCP7_SCHPO Meiotic coiled-coil protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcp7 PE=1 SV=1 Back     alignment and function description
>sp|Q54E86|MND1_DICDI Meiotic nuclear division protein 1 homolog OS=Dictyostelium discoideum GN=mnd1 PE=3 SV=1 Back     alignment and function description
>sp|P53102|MND1_YEAST Meiotic nuclear division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MND1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
359484516225 PREDICTED: meiotic nuclear division prot 1.0 1.0 0.835 1e-105
255546241227 Meiotic coiled-coil protein, putative [R 0.995 0.986 0.835 1e-104
356498300218 PREDICTED: meiotic nuclear division prot 0.968 1.0 0.816 1e-102
297738721210 unnamed protein product [Vitis vinifera] 0.933 1.0 0.833 2e-98
224122514206 predicted protein [Populus trichocarpa] 0.915 1.0 0.825 8e-96
449435810218 PREDICTED: meiotic nuclear division prot 0.968 1.0 0.844 5e-95
30688234230 meiotic nuclear division protein 1-like 0.955 0.934 0.776 1e-94
357157811207 PREDICTED: meiotic nuclear division prot 0.92 1.0 0.797 6e-94
115478342207 Os09g0280600 [Oryza sativa Japonica Grou 0.92 1.0 0.811 2e-93
297803128230 ATMND1 [Arabidopsis lyrata subsp. lyrata 0.955 0.934 0.762 4e-93
>gi|359484516|ref|XP_002283092.2| PREDICTED: meiotic nuclear division protein 1 homolog [Vitis vinifera] Back     alignment and taxonomy information
 Score =  388 bits (996), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/225 (83%), Positives = 206/225 (91%)

Query: 1   MSKKRGLSLEEKRGKILEIFYESQDFYLLKELEKLGPKKGVITQSVKDVVQSLVDDDLVL 60
           MSKKRGLSL+EKR K+LEIFYESQ+F+LLKELEKLGPKKGVI+QSVKDVVQSLVDDDLV 
Sbjct: 1   MSKKRGLSLDEKREKMLEIFYESQNFFLLKELEKLGPKKGVISQSVKDVVQSLVDDDLVA 60

Query: 61  KDKIGTSVYFWSLPSCAGNQLRNVYRKLESDLQSSKKRHTELVEQCNALKKGREESDERE 120
           KDKIGTSVYFWSLPSCAGNQLRNV+RKLESDLQS KKR +EL +QC+ LKKGREESDERE
Sbjct: 61  KDKIGTSVYFWSLPSCAGNQLRNVHRKLESDLQSGKKRLSELADQCDTLKKGREESDERE 120

Query: 121 EALEELKAVELKHIELKDEMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCS 180
           EAL ELKA+ELKH ELKDEMGQY+DNDPAAFE MK AIEVAHAAANRWTDNIFTL+QWCS
Sbjct: 121 EALGELKAIELKHKELKDEMGQYSDNDPAAFEEMKKAIEVAHAAANRWTDNIFTLRQWCS 180

Query: 181 NNFPQAKEELEQMYKDVGIPEDFDYLELSPVPLSSVGDQTVEGCP 225
           NNFP+AKE+LE MYK+VGI +DFDYLELS V   +VG+Q  EG P
Sbjct: 181 NNFPEAKEQLEHMYKEVGITDDFDYLELSTVLPGTVGNQMAEGNP 225

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255546241|ref|XP_002514180.1| Meiotic coiled-coil protein, putative [Ricinus communis] gi|223546636|gb|EEF48134.1| Meiotic coiled-coil protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356498300|ref|XP_003517991.1| PREDICTED: meiotic nuclear division protein 1 homolog [Glycine max] Back     alignment and taxonomy information
>gi|297738721|emb|CBI27966.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224122514|ref|XP_002330500.1| predicted protein [Populus trichocarpa] gi|222872434|gb|EEF09565.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449435810|ref|XP_004135687.1| PREDICTED: meiotic nuclear division protein 1 homolog [Cucumis sativus] gi|449489839|ref|XP_004158432.1| PREDICTED: meiotic nuclear division protein 1 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|30688234|ref|NP_194646.2| meiotic nuclear division protein 1-like protein [Arabidopsis thaliana] gi|75151407|sp|Q8GYD2.1|MND1_ARATH RecName: Full=Meiotic nuclear division protein 1 homolog; Short=AtMND1; AltName: Full=Meiotic nuclear division 1-like protein gi|26450501|dbj|BAC42364.1| unknown protein [Arabidopsis thaliana] gi|28973061|gb|AAO63855.1| unknown protein [Arabidopsis thaliana] gi|82408770|gb|ABB73190.1| meiotic nuclear division 1-like protein [Arabidopsis thaliana] gi|82775232|emb|CAJ44238.1| AtMnd1 protein [Arabidopsis thaliana] gi|332660196|gb|AEE85596.1| meiotic nuclear division protein 1-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|357157811|ref|XP_003577921.1| PREDICTED: meiotic nuclear division protein 1 homolog [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|115478342|ref|NP_001062766.1| Os09g0280600 [Oryza sativa Japonica Group] gi|49387852|dbj|BAD26517.1| putative MND1 domain containing protein [Oryza sativa Japonica Group] gi|113630999|dbj|BAF24680.1| Os09g0280600 [Oryza sativa Japonica Group] gi|218201818|gb|EEC84245.1| hypothetical protein OsI_30685 [Oryza sativa Indica Group] gi|222641210|gb|EEE69342.1| hypothetical protein OsJ_28662 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|297803128|ref|XP_002869448.1| ATMND1 [Arabidopsis lyrata subsp. lyrata] gi|297315284|gb|EFH45707.1| ATMND1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
TAIR|locus:2119881230 ATMND1 "AT4G29170" [Arabidopsi 0.955 0.934 0.562 3.2e-58
UNIPROTKB|Q32L19205 MND1 "Meiotic nuclear division 0.906 0.995 0.302 2.9e-23
MGI|MGI:1924165205 Mnd1 "meiotic nuclear division 0.906 0.995 0.307 2.9e-23
UNIPROTKB|Q9BWT6205 MND1 "Meiotic nuclear division 0.906 0.995 0.307 3.8e-23
ZFIN|ZDB-GENE-040801-116220 mnd1 "meiotic nuclear division 0.768 0.786 0.270 2.7e-13
POMBASE|SPAC13A11.03210 mcp7 "meiosis specific coiled- 0.897 0.961 0.246 1.3e-11
DICTYBASE|DDB_G0291750221 mnd1 "meiotic nuclear division 0.893 0.909 0.222 2.8e-11
TAIR|locus:2119881 ATMND1 "AT4G29170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 598 (215.6 bits), Expect = 3.2e-58, P = 3.2e-58
 Identities = 121/215 (56%), Positives = 139/215 (64%)

Query:     1 MSKKRGLSLEEKRGKILEIFYESQDFYXXXXXXXXXXXXXVITXXXXXXXXXXXXXXXXX 60
             MSKKRGLSLEEKR K+L+IFYESQDF+             VI+                 
Sbjct:     1 MSKKRGLSLEEKREKMLQIFYESQDFFLLKELEKMGPKKGVISQSVKDVIQSLVDDDLVA 60

Query:    61 XXXIGTSVYFWSLPSCAGNQLRNVYRKLESDLQSSKKRHTELVEQCNALXXXXXXXXXXX 120
                IG S+YFWSLPSCAGNQLR+V +KLESDLQ S KR  ELV+QC AL           
Sbjct:    61 KDKIGISIYFWSLPSCAGNQLRSVRQKLESDLQGSNKRLAELVDQCEALKKGREESEERT 120

Query:   121 XXXXXXXXXXXXHIELKDEMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCS 180
                         H +LK+EM Q+ADNDPA  EA +NAIEVAH +ANRWTDNIFTL+QWCS
Sbjct:   121 EALTQLKDIEKKHKDLKNEMVQFADNDPATLEAKRNAIEVAHQSANRWTDNIFTLRQWCS 180

Query:   181 NNFPQAKEELEQMYKDVGIPEDFDYLELSPVPLSS 215
             NNFPQAKE+LE +Y + GI EDFDY+ELS  PLSS
Sbjct:   181 NNFPQAKEQLEHLYTEAGITEDFDYIELSSFPLSS 215
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0006302 "double-strand break repair" evidence=RCA;IMP
GO:0009553 "embryo sac development" evidence=IMP
GO:0009555 "pollen development" evidence=RCA;IMP
GO:0010212 "response to ionizing radiation" evidence=RCA;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0000724 "double-strand break repair via homologous recombination" evidence=RCA
GO:0006261 "DNA-dependent DNA replication" evidence=RCA
GO:0006275 "regulation of DNA replication" evidence=RCA
GO:0006306 "DNA methylation" evidence=RCA
GO:0006312 "mitotic recombination" evidence=RCA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA
GO:0007062 "sister chromatid cohesion" evidence=RCA
GO:0007126 "meiosis" evidence=RCA
GO:0007129 "synapsis" evidence=RCA
GO:0007131 "reciprocal meiotic recombination" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0010332 "response to gamma radiation" evidence=RCA
GO:0016444 "somatic cell DNA recombination" evidence=RCA
GO:0016568 "chromatin modification" evidence=RCA
GO:0031047 "gene silencing by RNA" evidence=RCA
GO:0042138 "meiotic DNA double-strand break formation" evidence=RCA
GO:0042991 "transcription factor import into nucleus" evidence=RCA
GO:0043687 "post-translational protein modification" evidence=RCA
GO:0045132 "meiotic chromosome segregation" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0051726 "regulation of cell cycle" evidence=RCA
UNIPROTKB|Q32L19 MND1 "Meiotic nuclear division protein 1 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1924165 Mnd1 "meiotic nuclear divisions 1 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BWT6 MND1 "Meiotic nuclear division protein 1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-116 mnd1 "meiotic nuclear divisions 1 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPAC13A11.03 mcp7 "meiosis specific coiled-coil protein Mcp7" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291750 mnd1 "meiotic nuclear division protein 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q32L19MND1_BOVINNo assigned EC number0.42780.90660.9951yesno
Q8K396MND1_MOUSENo assigned EC number0.43260.90660.9951yesno
Q9BWT6MND1_HUMANNo assigned EC number0.43260.90660.9951yesno
Q09739MCP7_SCHPONo assigned EC number0.39420.88880.9523yesno
P53102MND1_YEASTNo assigned EC number0.31410.82220.8447yesno
Q54E86MND1_DICDINo assigned EC number0.31880.89330.9095yesno
Q8GYD2MND1_ARATHNo assigned EC number0.77670.95550.9347yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
pfam03962188 pfam03962, Mnd1, Mnd1 family 1e-77
COG5124209 COG5124, COG5124, Protein predicted to be involved 3e-37
>gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family Back     alignment and domain information 
 Score =  231 bits (591), Expect = 1e-77
 Identities = 101/191 (52%), Positives = 130/191 (68%), Gaps = 4/191 (2%)

Query: 16  ILEIFYESQDFYLLKELEKLGPK-KGVITQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLP 74
           ILEIF E++ FY LKELEKL PK KG+ + SVK+V+QSLVDD LV  +KIGTS Y+WS P
Sbjct: 1   ILEIFQETKTFYTLKELEKLAPKVKGISSMSVKEVLQSLVDDGLVRTEKIGTSNYYWSFP 60

Query: 75  SCAGNQLRNVYRKLESDLQSSKKRHTELVEQCNALKKGREESDEREEALEELKAVELKHI 134
           S A N+L+    KL+ +L+  K+R  EL  Q   LKKGREE++ER E LEELK +E +  
Sbjct: 61  SQALNKLKTRLEKLKKELEELKQRIAELQAQIEKLKKGREETEERTELLEELKQLEKELK 120

Query: 135 ELKDEMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFTLQQWCSNNFPQAKEELEQMY 194
           +LK E+ +Y  NDP   E +K   +VA  AANRWTDNIF+L+ + S  F   + +L +  
Sbjct: 121 KLKAELEKYEKNDPERIEKLKEETKVAKEAANRWTDNIFSLKSYLSKKFGLDEAQLRKE- 179

Query: 195 KDVGIPEDFDY 205
              GIPEDFDY
Sbjct: 180 --FGIPEDFDY 188

This family of proteins includes MND1 from S. cerevisiae. The mnd1 protein forms a complex with hop2 to promote homologous chromosome pairing and meiotic double-strand break repair. Length = 188
>gnl|CDD|227453 COG5124, COG5124, Protein predicted to be involved in meiotic recombination [Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 100.0
KOG3433203 consensus Protein involved in meiotic recombinatio 100.0
COG5124209 Protein predicted to be involved in meiotic recomb 100.0
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 98.67
KOG4603201 consensus TBP-1 interacting protein [Signal transd 97.48
PF0867967 DsrD: Dissimilatory sulfite reductase D (DsrD); In 96.99
KOG3433203 consensus Protein involved in meiotic recombinatio 96.43
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 95.89
PF03965115 Penicillinase_R: Penicillinase repressor; InterPro 95.5
PF02002105 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024 95.4
cd07153116 Fur_like Ferric uptake regulator(Fur) and related 95.0
PF01475120 FUR: Ferric uptake regulator family; InterPro: IPR 94.69
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 94.53
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 94.51
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 94.44
PRK06266178 transcription initiation factor E subunit alpha; V 94.43
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 94.1
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 93.93
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 93.13
PRK09462148 fur ferric uptake regulator; Provisional 92.77
TIGR02698130 CopY_TcrY copper transport repressor, CopY/TcrY fa 91.76
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 91.67
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 91.52
PRK06474178 hypothetical protein; Provisional 91.34
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 91.2
PTZ00464211 SNF-7-like protein; Provisional 91.13
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 90.8
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 90.64
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 90.6
COG1777217 Predicted transcriptional regulators [Transcriptio 90.47
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 89.79
PF05158 327 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; Inter 89.72
TIGR02702203 SufR_cyano iron-sulfur cluster biosynthesis transc 89.6
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 89.6
PRK11639169 zinc uptake transcriptional repressor; Provisional 89.55
COG1675176 TFA1 Transcription initiation factor IIE, alpha su 89.08
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 88.96
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 88.86
COG2433652 Uncharacterized conserved protein [Function unknow 88.79
PRK10141117 DNA-binding transcriptional repressor ArsR; Provis 88.42
PF09744158 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; Inte 88.24
PF1373055 HTH_36: Helix-turn-helix domain 88.15
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 87.97
smart00531147 TFIIE Transcription initiation factor IIE. 87.62
PF15556252 Zwint: ZW10 interactor 86.89
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 86.68
PF0500879 V-SNARE: Vesicle transport v-SNARE protein N-termi 86.37
PRK11637 428 AmiB activator; Provisional 86.29
PF13851201 GAS: Growth-arrest specific micro-tubule binding 85.36
PF05010207 TACC: Transforming acidic coiled-coil-containing p 85.27
PRK02224 880 chromosome segregation protein; Provisional 84.94
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 84.93
COG3883265 Uncharacterized protein conserved in bacteria [Fun 84.62
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 84.59
cd0476691 HTH_HspR Helix-Turn-Helix DNA binding domain of th 84.56
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 84.52
PF08784102 RPA_C: Replication protein A C terminal; InterPro: 84.34
PF07798177 DUF1640: Protein of unknown function (DUF1640); In 84.15
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 83.27
COG1497260 Predicted transcriptional regulator [Transcription 82.99
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 82.94
PRK11637 428 AmiB activator; Provisional 82.73
PF1359184 MerR_2: MerR HTH family regulatory protein 82.65
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 82.42
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 81.94
PF06476115 DUF1090: Protein of unknown function (DUF1090); In 81.68
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 81.6
PRK10411240 DNA-binding transcriptional activator FucR; Provis 81.52
PF12761195 End3: Actin cytoskeleton-regulatory complex protei 81.43
PF1518885 CCDC-167: Coiled-coil domain-containing protein 16 81.36
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 81.18
PHA00738108 putative HTH transcription regulator 81.09
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information 
Probab=100.00  E-value=5.1e-72  Score=474.78  Aligned_cols=187  Identities=53%  Similarity=0.866  Sum_probs=184.7

Q ss_pred             HHHHHhhccCccchHHHHhhccC-CCcchhcHHHHHHHhhhcCccccccccceeeEEcccchhhhhHHHHHHHHHHHHHH
Q 027291           16 ILEIFYESQDFYLLKELEKLGPK-KGVITQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSCAGNQLRNVYRKLESDLQS   94 (225)
Q Consensus        16 il~~f~e~~~~ytlKELEK~~pK-kGI~~~~VKdvlQ~LVDDglV~~EKiGssN~YWsFps~~~~~~~~~~~~l~~~i~~   94 (225)
                      ||+|||++++|||||||||+||| +||++|+||||||+|||||||++||||||||||||||++.+.+++.+++|+++++.
T Consensus         1 il~~f~e~~~~y~lKELEK~~pK~~gI~~~~VKdvlq~LvDDglV~~EKiGssn~YWsFps~~~~~~~~~~~~l~~~~~~   80 (188)
T PF03962_consen    1 ILEIFHESKDFYTLKELEKLAPKEKGIVSMSVKDVLQSLVDDGLVHVEKIGSSNYYWSFPSQAKQKRQNKLEKLQKEIEE   80 (188)
T ss_pred             ChHHHhhcCCcccHHHHHHHcccccCCchhhHHHHHHHHhccccchhhhccCeeEEEecChHHHHHHHHHHHHHHHHHHH
Confidence            68999999999999999999999 99999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCHHHHHHHHHHHHHHHHHHHhhhhhHHH
Q 027291           95 SKKRHTELVEQCNALKKGREESDEREEALEELKAVELKHIELKDEMGQYADNDPAAFEAMKNAIEVAHAAANRWTDNIFT  174 (225)
Q Consensus        95 ~~~~i~~l~~~ie~~k~~r~~~~eR~~ll~~l~~L~~~~~~l~~el~~~~~~Dp~~i~~~k~~~~~~k~aanrwTDNI~~  174 (225)
                      ++.++++++.+|+.++.+|+++++|..+|+++++|+.++++|+++|++|+.+||+.|+++++++..++++|||||||||+
T Consensus        81 ~~~~i~~l~~~i~~~~~~r~~~~eR~~~l~~l~~l~~~~~~l~~el~~~~~~Dp~~i~~~~~~~~~~~~~anrwTDNI~~  160 (188)
T PF03962_consen   81 LEKKIEELEEKIEEAKKGREESEEREELLEELEELKKELKELKKELEKYSENDPEKIEKLKEEIKIAKEAANRWTDNIFS  160 (188)
T ss_pred             HHHHHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHHHHhhHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhCCCCHHHHHHHHhhcCCCCCccc
Q 027291          175 LQQWCSNNFPQAKEELEQMYKDVGIPEDFDY  205 (225)
Q Consensus       175 l~~~~~kk~~~~~~~~~~l~~~fgIp~d~dy  205 (225)
                      |++||+++|||++++   |+++||||+||||
T Consensus       161 l~~~~~~k~~~~~~~---i~k~f~Ip~d~dy  188 (188)
T PF03962_consen  161 LKSYLKKKFGMDEED---IRKEFGIPEDFDY  188 (188)
T ss_pred             HHHHHHHhcCCCHHH---HHHHcCCccccCC
Confidence            999999999999999   5679999999998

The mnd1 protein forms a complex with hop2 to promote homologous chromosome pairing and meiotic double-strand break repair [].
>KOG3433 consensus Protein involved in meiotic recombination/predicted coiled-coil protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5124 Protein predicted to be involved in meiotic recombination [Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>KOG4603 consensus TBP-1 interacting protein [Signal transduction mechanisms] Back     alignment and domain information
>PF08679 DsrD: Dissimilatory sulfite reductase D (DsrD); InterPro: IPR014793 The structure of the dissimilatory sulphite reductase D (DsrD) protein has shown it to contain a winged-helix motif similar to those found in DNA binding proteins [] Back     alignment and domain information
>KOG3433 consensus Protein involved in meiotic recombination/predicted coiled-coil protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>PF03965 Penicillinase_R: Penicillinase repressor; InterPro: IPR005650 Proteins in this entry are transcriptional regulators found in a variety of bacteria and a small number of archaea Back     alignment and domain information
>PF02002 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024550 The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation, together with RNA polymerase II and other general factors Back     alignment and domain information
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators Back     alignment and domain information
>PF01475 FUR: Ferric uptake regulator family; InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>PRK09462 fur ferric uptake regulator; Provisional Back     alignment and domain information
>TIGR02698 CopY_TcrY copper transport repressor, CopY/TcrY family Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06474 hypothetical protein; Provisional Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PTZ00464 SNF-7-like protein; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>COG1777 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF05158 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; InterPro: IPR007832 The family comprises a subunit specific to RNA Pol III, the tRNA specific polymerase Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PRK11639 zinc uptake transcriptional repressor; Provisional Back     alignment and domain information
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription] Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>PF09744 Jnk-SapK_ap_N: JNK_SAPK-associated protein-1; InterPro: IPR019143 This entry represents the N-terminal 200 residues of a set of proteins conserved from yeasts to humans Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF15556 Zwint: ZW10 interactor Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05008 V-SNARE: Vesicle transport v-SNARE protein N-terminus; InterPro: IPR007705 V-SNARE proteins are required for protein traffic between eukaryotic organelles Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF08784 RPA_C: Replication protein A C terminal; InterPro: IPR014892 This protein corresponds to the C-terminal of the single stranded DNA binding protein RPA (replication protein A) Back     alignment and domain information
>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>COG1497 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF13591 MerR_2: MerR HTH family regulatory protein Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF06476 DUF1090: Protein of unknown function (DUF1090); InterPro: IPR009468 This family consists of several bacterial proteins of unknown function and is known as YqjC in Escherichia coli Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PRK10411 DNA-binding transcriptional activator FucR; Provisional Back     alignment and domain information
>PF12761 End3: Actin cytoskeleton-regulatory complex protein END3 Back     alignment and domain information
>PF15188 CCDC-167: Coiled-coil domain-containing protein 167 Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information
>PHA00738 putative HTH transcription regulator Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 54.5 bits (130), Expect = 6e-09
 Identities = 42/225 (18%), Positives = 77/225 (34%), Gaps = 58/225 (25%)

Query: 11  EKRGKILEIFYESQDFYLLKEL-EKLG--------PKK-------GVITQSVKDVVQSLV 54
           +K   I+E      +    +++ ++L         P          VI   V  VV  L 
Sbjct: 353 DKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLH 412

Query: 55  DDDLVLKDKIGTSVYFWSLPSCAGNQLRNVYRKLESDLQSSKKRHTELVEQCNALKKGRE 114
              LV K    +++            + ++Y +L+  L++    H  +V+  N + K  +
Sbjct: 413 KYSLVEKQPKESTIS-----------IPSIYLELKVKLENEYALHRSIVDHYN-IPKTFD 460

Query: 115 ESDEREEALEE---------LKAVELKHIELKDEMGQ-YADNDPAAFEAMKNAIEVAHAA 164
             D     L++         LK +E  H E        + D     F  ++  I     A
Sbjct: 461 SDDLIPPYLDQYFYSHIGHHLKNIE--HPERMTLFRMVFLD-----FRFLEQKIRHDSTA 513

Query: 165 ANRWTDNIFTLQQ------WCSNNFPQAKEELEQMYKDVGIPEDF 203
            N     + TLQQ      +  +N P    + E++   +    DF
Sbjct: 514 WNASGSILNTLQQLKFYKPYICDNDP----KYERLVNAI---LDF 551
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
1p6r_A82 Penicillinase repressor; transcription regulation, 96.74
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 96.73
1ucr_A78 Protein DSVD; dissimilatory sulfite reductase D, D 96.53
2o03_A131 Probable zinc uptake regulation protein FURB; DNA- 95.81
2g9w_A138 Conserved hypothetical protein; DNA-binding domain 95.68
2oqg_A114 Possible transcriptional regulator, ARSR family P; 95.64
2xub_A534 DNA-directed RNA polymerase III subunit RPC3; tran 95.3
1sd4_A126 Penicillinase repressor; BLAI, MECI, methicillin, 95.18
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 95.13
2k4b_A99 Transcriptional regulator; DNA binding protein, wi 95.05
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 94.83
3jth_A98 Transcription activator HLYU; transcription factor 94.67
2fe3_A145 Peroxide operon regulator; oxidative stress regula 94.61
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 94.35
1mzb_A136 Ferric uptake regulation protein; ferric uptake re 94.01
2w57_A150 Ferric uptake regulation protein; gene regulation, 93.94
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 93.82
1ku9_A152 Hypothetical protein MJ223; putative transcription 93.72
3mwm_A139 ZUR, putative metal uptake regulation protein; FUR 93.6
2xig_A150 Ferric uptake regulation protein; hpfur, transcrip 93.59
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 93.29
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 93.27
1okr_A123 MECI, methicillin resistance regulatory protein ME 93.2
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 92.96
2kko_A108 Possible transcriptional regulatory protein (possi 92.87
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 92.29
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 92.2
3f6o_A118 Probable transcriptional regulator, ARSR family pr 91.7
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 91.6
1sfx_A109 Conserved hypothetical protein AF2008; structural 91.39
3cuq_B218 Vacuolar protein-sorting-associated protein 36; ES 91.06
1y0u_A96 Arsenical resistance operon repressor, putative; s 90.96
3cuq_A234 Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, nu 90.6
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 90.55
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 90.41
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 90.26
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 90.09
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 90.07
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 89.85
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 89.73
2p4w_A202 Transcriptional regulatory protein ARSR family; ar 89.61
3eyy_A145 Putative iron uptake regulatory protein; NUR, nick 89.24
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 88.58
3f6v_A151 Possible transcriptional regulator, ARSR family pr 88.45
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 88.35
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 88.3
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 87.9
4ets_A162 Ferric uptake regulation protein; metal binding pr 87.66
2dk8_A81 DNA-directed RNA polymerase III 39 kDa polypeptide 87.45
1qbj_A81 Protein (double-stranded RNA specific adenosine D 87.12
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 87.03
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 86.55
1u5t_A233 Appears to BE functionally related to SNF7; SNF8P; 85.92
3kp7_A151 Transcriptional regulator TCAR; multiple drug resi 85.57
2gxg_A146 146AA long hypothetical transcriptional regulator; 85.49
2jt1_A77 PEFI protein; solution structure, winged helix-tur 85.42
2qlz_A232 Transcription factor PF0095; 2.50A {Pyrococcus fur 84.62
2v4h_A110 NF-kappa-B essential modulator; transcription, met 84.61
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 84.29
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 84.15
3onj_A97 T-snare VTI1; helix, HABC, protein transport; 1.92 84.09
2zkz_A99 Transcriptional repressor PAGR; protein-DNA, HTH m 83.76
4aik_A151 Transcriptional regulator SLYA; transcription, tra 83.48
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 83.43
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 83.38
3r0a_A123 Putative transcriptional regulator; structural gen 83.02
1lj9_A144 Transcriptional regulator SLYA; HTH DNA binding pr 82.55
2qc0_A373 Uncharacterized protein; NP_719793.1, uncharacteri 82.4
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 82.39
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 82.2
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 82.11
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 81.56
2nnn_A140 Probable transcriptional regulator; structural gen 81.48
3f3x_A144 Transcriptional regulator, MARR family, putative; 81.27
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 81.24
3boq_A160 Transcriptional regulator, MARR family; MARR famil 81.16
2lkp_A119 Transcriptional regulator, ARSR family; symmetric 81.0
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 80.8
1u5t_B169 Defective in vacuolar protein sorting; VPS36P; ESC 80.56
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 80.55
1s3j_A155 YUSO protein; structural genomics, MARR transcript 80.47
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 80.36
3oop_A143 LIN2960 protein; protein structure initiative, PSI 80.1
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
Probab=96.74  E-value=0.0034  Score=44.26  Aligned_cols=73  Identities=14%  Similarity=0.130  Sum_probs=61.3

Q ss_pred             CCCCCCCCHHHHHHHHHHHHhhccCccchHHHHhhccC-CCcchhcHHHHHHHhhhcCccccccccceeeEEcccch
Q 027291            1 MSKKRGLSLEEKRGKILEIFYESQDFYLLKELEKLGPK-KGVITQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSC   76 (225)
Q Consensus         1 mm~~KglS~eEKr~ril~~f~e~~~~ytlKELEK~~pK-kGI~~~~VKdvlQ~LVDDglV~~EKiGssN~YWsFps~   76 (225)
                      |.+..|||..+  ..||.++.. ...-+..||-..... .|+..-+|--+|..|++.|+|...+.|-..+|....+.
T Consensus         1 m~~~~~lt~~e--~~vL~~L~~-~~~~t~~ei~~~l~~~~~~s~~Tv~~~l~rL~~kGlv~r~~~gr~~~y~~~~~~   74 (82)
T 1p6r_A            1 MKKIPQISDAE--LEVMKVIWK-HSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTPNIDE   74 (82)
T ss_dssp             CCCCCCCCHHH--HHHHHHHHT-SSSEEHHHHHHHHHHHSCCCHHHHHHHHHHHHHTTSEEEEEETTEEEEEESCSS
T ss_pred             CCccCCCCHHH--HHHHHHHHc-CCCCCHHHHHHHHhhcCCccHHHHHHHHHHHHHCCCeEEEecCCEEEEEeecCH
Confidence            44446899876  568999988 557899999998877 78999999999999999999999999998888765543
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>1ucr_A Protein DSVD; dissimilatory sulfite reductase D, DNA binding motif, sulfate-reducing bacteria, winged-helix motif, unknown function; 1.20A {Desulfovibrio vulgaris} SCOP: a.4.5.45 PDB: 1wq2_A Back     alignment and structure
>2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2xub_A DNA-directed RNA polymerase III subunit RPC3; transcription, winged helix; 2.80A {Homo sapiens} PDB: 2xv4_S Back     alignment and structure
>1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 Back     alignment and structure
>2w57_A Ferric uptake regulation protein; gene regulation, transcription regulation, transport, iron, repressor, DNA-binding, transcription; 2.60A {Vibrio cholerae} Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>3mwm_A ZUR, putative metal uptake regulation protein; FUR, regulatory metal, graded transcription regulation, transcription; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>3cuq_B Vacuolar protein-sorting-associated protein 36; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_B Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>3cuq_A Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_A Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 Back     alignment and structure
>3eyy_A Putative iron uptake regulatory protein; NUR, nickel-uptake regulator, D-domain, dimerization domain, DB-domain, DNA-binding domain; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>4ets_A Ferric uptake regulation protein; metal binding protein, transcription factor; 2.10A {Campylobacter jejuni subsp} Back     alignment and structure
>2dk8_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, RNA_POL_RPC34 domain, RNA polymerase III C39 subunit, NPPSFA; NMR {Mus musculus} SCOP: a.4.5.85 Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>1u5t_A Appears to BE functionally related to SNF7; SNF8P; ESCRT, endosomal, trafficking, protein complex, transport protein; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 PDB: 1w7p_A Back     alignment and structure
>3kp7_A Transcriptional regulator TCAR; multiple drug resistance, biofilm, transcription regulation, binding, transcription regulator; 2.30A {Staphylococcus epidermidis RP62A} PDB: 3kp3_A* 3kp4_A* 3kp5_A* 3kp2_A* 3kp6_A Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3onj_A T-snare VTI1; helix, HABC, protein transport; 1.92A {Saccharomyces cerevisiae} PDB: 3onl_C Back     alignment and structure
>2zkz_A Transcriptional repressor PAGR; protein-DNA, HTH motif, dimer, DN binding, transcription regulation; 2.00A {Bacillus anthracis} Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>1lj9_A Transcriptional regulator SLYA; HTH DNA binding protein, structural genomics, PSI, protein structure initiative; 1.60A {Enterococcus faecalis} SCOP: a.4.5.28 Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>2nnn_A Probable transcriptional regulator; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3boq_A Transcriptional regulator, MARR family; MARR famil structural genomics, PSI-2, protein structure initiative; 2.39A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2lkp_A Transcriptional regulator, ARSR family; symmetric homodimer, NI(II) binding protein, DNA binding Pro transcription regulator; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>1u5t_B Defective in vacuolar protein sorting; VPS36P; ESCRT, endosomal, trafficking, protein complex, transport protein; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>3oop_A LIN2960 protein; protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG, unknown function; 1.78A {Listeria innocua} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d2g9wa1122 Hypothetical protein Rv1846c {Mycobacterium tuberc 96.94
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 95.77
d1ucra_74 Dissimilatory sulfite reductase DsvD {Desulfovibri 95.55
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 95.39
d1p6ra_82 Penicillinase repressor BlaI {Bacillus licheniform 94.88
d1sd4a_122 Penicillinase repressor BlaI {Staphylococcus aureu 94.34
d1okra_120 Methicillin resistance regulatory protein MecI {St 93.99
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 93.01
d1u5ta268 Vacuolar sorting protein SNF8 {Baker's yeast (Sacc 92.8
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 92.51
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 92.45
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 92.07
d1mzba_134 Ferric uptake regulation protein, FUR {Pseudomonas 91.64
d1ulya_190 Hypothetical protein PH1932 {Pyrococcus horikoshii 90.65
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 88.23
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 88.1
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 87.82
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 87.51
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 86.71
d1q1ha_88 Transcription factor E/IIe-alpha, N-terminal domai 85.42
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 85.24
d2p4wa1194 Transcriptional regulatory protein PF1790 {Pyrococ 85.21
d1mkma175 Transcriptional regulator IclR, N-terminal domain 84.37
>d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Penicillinase repressor
domain: Hypothetical protein Rv1846c
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=96.94  E-value=0.0011  Score=49.31  Aligned_cols=70  Identities=13%  Similarity=0.179  Sum_probs=59.9

Q ss_pred             CCHHHHHHHHHHHHhhccCccchHHHHhhccC-CCcchhcHHHHHHHhhhcCccccccccceeeEEcccchhh
Q 027291            7 LSLEEKRGKILEIFYESQDFYLLKELEKLGPK-KGVITQSVKDVVQSLVDDDLVLKDKIGTSVYFWSLPSCAG   78 (225)
Q Consensus         7 lS~eEKr~ril~~f~e~~~~ytlKELEK~~pK-kGI~~~~VKdvlQ~LVDDglV~~EKiGssN~YWsFps~~~   78 (225)
                      ||.-|  ..|++++-..+...|.+||-..+|. +++...||.=+|..|++-|+|..++.|...+|++.-+.+.
T Consensus         5 L~~~E--~~IM~~lW~~g~~~t~~eI~~~l~~~~~~~~sTV~T~L~rL~~Kg~l~~~~~gr~~~Y~~~i~~e~   75 (122)
T d2g9wa1           5 LGDLE--RAVMDHLWSRTEPQTVRQVHEALSARRDLAYTTVMAVLQRLAKKNLVLQIRDDRAHRYAPVHGRDE   75 (122)
T ss_dssp             CCHHH--HHHHHHHHTCSSCEEHHHHHHHHTTTCCCCHHHHHHHHHHHHHTTSEEEEC---CCEEEESSCHHH
T ss_pred             CCHHH--HHHHHHHHcCCCCccHHHHHHHHhccCCCcHHHHHHHHHHHHHCCCEEEeecCCeEEEEeCCCHHH
Confidence            45444  5789999999999999999999998 8999999999999999999999999999999999887654
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ucra_ a.4.5.45 (A:) Dissimilatory sulfite reductase DsvD {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p6ra_ a.4.5.39 (A:) Penicillinase repressor BlaI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1sd4a_ a.4.5.39 (A:) Penicillinase repressor BlaI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1okra_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d1u5ta2 a.4.5.54 (A:165-232) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1q1ha_ a.4.5.41 (A:) Transcription factor E/IIe-alpha, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure